1JZAA

Crystal structure of variant 2 scorpion toxin from centruroides sculpturatus ewing
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
66
structure length
66
Chain Sequence
b'KEGYLVNKSTGCKYGCLKLGENEGCDKECKAKNQGGSYGYCYAFACWCEGLPESTPTYPLPNKSCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROTOXIN 2
publication title Structure of variant 2 scorpion toxin from Centruroides sculpturatus Ewing.
pubmed doi rcsb
molecule tags Toxin
total genus 16
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1jzaA00
1MR4A 2ATBA 2LJMA 2B3CA 1CHZA 2KSKA 4CQKA 1NH5A 2KYQA 4HE7A 2NY8X 1JZAA 1AYJA 5CY0A 2KGQA 1ZVGA 1BMRA 1BRZA 4AEIA 2YC1C 1T0ZA 1ZYWA 1NRAA 1VNAA 1LQQA 1ZVEA 1PX9A 2KBJA 2LR3A 1NPIA 1MYNA 1JXCA 5KK4A 1N4NA 2NY9X 1SN4A 3PSMA 1I2UA 1DJTA 1C56A 2LKBA 1PTXA 1ZYVA 1L4VA 1P00A 1NRBA 2N2QA 1I2VA 2YBRC 4KYPA 4AB0A 1NE5A 2E3FA 1SN1A 3E7RL 1VNBA 1ICAA 1JKZA 1TI5A 2LJ7A 4UJ0A 1PE4A 4HHFA 1C55A 1AHOA 1T7AA 1JZBA 1BCGA 1P0AA 1OMYA 1ZUTA 2KJAA 2LY6A 2SN3A 1WWNA 1T1TA 2N66A 1WMTA 2KPYA 1GPTA 1I6GA 1OZZA 2N69A 2B68A 2N2RA 2YEOA 2MZ0A 2LY5A 1B3CA 1FH3A 2KBHA 1LQIA 2M8BB 2KBKA 1ZU3A 2A7TA 1T7BA 1T7EA 2LI7A 2LT8A 3E7UX 1ZFUA 1GPSA 1LQHA 1SEGA 4AAZA 2GL1A 4V1DC 1BK8A 1KV0A 1CN2A 1I6FA 2I61A 1WT7A 1DQ7A 1B7DA 2E3GA 2ASCA 2BRZA 1SNBA 2E0HA
chains in the Genus database with same CATH superfamily
1MR4A 2QW9A 3LDPA 2ATBA 2LJMA 2B3CA 1CHZA 2KSKA 2BUPA 4CQKA 1NH5A 3D2FA 4H5WA 1XRSB 3KOXA 3FZKA 5AQKA 3I33A 3BK3C 1KAXA 2QWQA 2KYQA 3KOWA 5BN8A 5AQLA 4HE7A 5AQGA 5EX5A 2NY8X 1JZAA 2YIPA 1BUPA 1AYJA 5CY0A 2KGQA 1KAYA 1ZVGA 5AQPA 1BMRA 1BRZA 4AEIA 4GNIA 2K35A 2YC1C 1T0ZA 3ATUA 1ZYWA 5AQUA 1NRAA 3CQXA 1VNAA 1NGJA 3QFPA 4UAEF 1LQQA 1NGEA 1ZVEA 3D2EA 1PX9A 3FZFA 1QQOA 5AQQA 5AQNA 2KBJA 5EY4A 2YILA 2LR3A 3L4IA 1K8BA 1NPIA 3HSCA 1S3XA 1MYNA 2QWNA 3ATVA 3LDQA 3GDQA 2E2FA 1JXCA 2MN5A 3JXUA 1GPSA 3AY9A 5KK4A 2GMOA 4H5RA 5AQSA 1N4NA 2NY9X 1SN4A 3CW4A 3PSMA 3QMLA 1I2UA 1BA0A 2JDQD 1NGDA 1DJTA 2QWLA 3LDNA 1UGLA 1NGAA 3QI7A 1C56A 5AQRA 1ATRA 2LKBA 2KHOA 1PTXA 4KBOA 5AQOA 2E8AA 3C7NB 5EVZA 5AQHA 5AQIA 1ZYVA 1L4VA 1NGGA 3GKUA 5FPNA 1P00A 1HJOA 3FZHA 3IUCA 1NGFA 1NRBA 2N2QA 3R2VA 5FPDA 1I2VA 5F0XA 2YBRC 5AR0A 5AQYA 1BA1A 5EXWA 3A8YA 4KYPA 4AB0A 1NE5A 2E3FA 1SN1A 3E7RL 1VNBA 1ICAA 5F1XA 1NGIA 3KVGA 3FE1A 1TI5A 2LJ7A 4UJ0A 1JKZA 4FL9A 4FSVA 4H5TA 1PE4A 4HHFA 1C55A 4UADE 1AHOA 2MBKA 3D2FB 1T7AA 4UAFE 1JZBA 5AQXA 5FPMA 1BCGA 1P0AA 1OMYA 1ZUTA 2KJAA 3LDOA 3M3ZA 2LY6A 3FZMA 2SN3A 2LN8A 1WWNA 1T1TA 2D56A 1QQMA 1NGBA 2N66A 4HWIA 1WMTA 2KPYA 3L6QA 1GPTA 1I6GA 1OZZA 2N69A 2B68A 2YIOA 2N2RA 2YEOA 2MZ0A 1HPMA 2LY5A 1ATSA 3FZLA 4H5NA 5AQWA 1B3CA 1FH3A 2G2KA 2KBHA 1DKGD 1LQIA 1YUWA 2M8BB 2E88A 3D2EB 1NGHA 2KBKA 1ZU3A 2A7TA 1T7BA 1T7EA 2LI7A 2LT8A 5BN9A 3KOYA 2QWMA 3GL1A 3E7UX 1ZFUA 5AQFA 5BPMA 1LQHA 1SEGA 3KHWA 3L56A 2GL1A 4AAZA 2QWOA 4IO8A 2QWPA 3C7NA 3QFUA 5AQMA 3KC6A 4V1DC 3KP1A 5AQVA 3SF4D 3KOZA 4H5VA 1BK8A 1KV0A 1QQNA 5AQJA 1I6FA 3LDLA 5F2RA 5BPNA 1CN2A 5AQTA 2I61A 2V7ZA 5BPLA 1WT7A 1DQ7A 2VY6A 1NGCA 1B7DA 2QXLA 2E3GA 2ASCA 2BRZA 5FPEA 1POIA 1KAZA 2QWRA 5AQZA 3KP0A 1HX1A 1SNBA 2E0HA
chains in the Genus database with same CATH topology
1MR4A 2ATBA 2LJMA 2B3CA 1CHZA 2KSKA 4CQKA 1NH5A 2KYQA 4HE7A 2NY8X 1JZAA 1AYJA 5CY0A 2KGQA 1ZVGA 1BMRA 1BRZA 4AEIA 2YC1C 1T0ZA 1ZYWA 1NRAA 1VNAA 1LQQA 1ZVEA 1PX9A 2KBJA 2LR3A 1NPIA 1MYNA 1JXCA 5KK4A 1N4NA 2NY9X 1SN4A 3PSMA 1I2UA 1DJTA 1C56A 2LKBA 1PTXA 1ZYVA 1L4VA 1P00A 1NRBA 2N2QA 1I2VA 2YBRC 4KYPA 4AB0A 1NE5A 2E3FA 1SN1A 3E7RL 1VNBA 1ICAA 1JKZA 1TI5A 2LJ7A 4UJ0A 1PE4A 4HHFA 1C55A 1AHOA 1T7AA 1JZBA 1BCGA 1P0AA 1OMYA 1ZUTA 2KJAA 2LY6A 2SN3A 1WWNA 1T1TA 2N66A 1WMTA 2KPYA 1GPTA 1I6GA 1OZZA 2N69A 2B68A 2N2RA 2YEOA 2MZ0A 2LY5A 1B3CA 1FH3A 2KBHA 1LQIA 2M8BB 2KBKA 1ZU3A 2A7TA 1T7BA 1T7EA 2LI7A 2LT8A 3E7UX 1ZFUA 1GPSA 1LQHA 1SEGA 4AAZA 2GL1A 4V1DC 1BK8A 1KV0A 1CN2A 1I6FA 2I61A 1WT7A 1DQ7A 1B7DA 2E3GA 2ASCA 2BRZA 1SNBA 2E0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MR4 A;  2ATB A;  2LJM A;  2B3C A;  1CHZ A;  2KSK A;  4CQK A;  1NH5 A;  2KYQ A;  4HE7 A;  2NY8 X;  1JZA A;  1AYJ A;  5CY0 A;  2KGQ A;  1ZVG A;  1BMR A;  1BRZ A;  4AEI A;  2YC1 C;  1T0Z A;  1ZYW A;  1NRA A;  1VNA A;  1LQQ A;  1ZVE A;  1PX9 A;  2KBJ A;  2LR3 A;  1NPI A;  1MYN A;  1JXC A;  5KK4 A;  1N4N A;  2NY9 X;  1SN4 A;  3PSM A;  1I2U A;  1DJT A;  1C56 A;  2LKB A;  1PTX A;  1ZYV A;  1L4V A;  1P00 A;  1NRB A;  2N2Q A;  1I2V A;  2YBR C;  4KYP A;  4AB0 A;  1NE5 A;  2E3F A;  1SN1 A;  3E7R L;  1VNB A;  1ICA A;  1JKZ A;  1TI5 A;  2LJ7 A;  4UJ0 A;  1PE4 A;  4HHF A;  1C55 A;  1AHO A;  1T7A A;  1JZB A;  1BCG A;  1P0A A;  1OMY A;  1ZUT A;  2KJA A;  2LY6 A;  2SN3 A;  1WWN A;  1T1T A;  2N66 A;  1WMT A;  2KPY A;  1GPT A;  1I6G A;  1OZZ A;  2N69 A;  2B68 A;  2N2R A;  2YEO A;  2MZ0 A;  2LY5 A;  1B3C A;  1FH3 A;  2KBH A;  1LQI A;  2M8B B;  2KBK A;  1ZU3 A;  2A7T A;  1T7B A;  1T7E A;  2LI7 A;  2LT8 A;  3E7U X;  1ZFU A;  1GPS A;  1LQH A;  1SEG A;  4AAZ A;  2GL1 A;  4V1D C;  1BK8 A;  1KV0 A;  1CN2 A;  1I6F A;  2I61 A;  1WT7 A;  1DQ7 A;  1B7D A;  2E3G A;  2ASC A;  2BRZ A;  1SNB A;  2E0H A; 
#chains in the Genus database with same CATH topology
 1MR4 A;  2QW9 A;  3LDP A;  2ATB A;  2LJM A;  2B3C A;  1CHZ A;  2KSK A;  2BUP A;  4CQK A;  1NH5 A;  3D2F A;  4H5W A;  1XRS B;  3KOX A;  3FZK A;  5AQK A;  3I33 A;  3BK3 C;  1KAX A;  2QWQ A;  2KYQ A;  3KOW A;  5BN8 A;  5AQL A;  4HE7 A;  5AQG A;  5EX5 A;  2NY8 X;  1JZA A;  2YIP A;  1BUP A;  1AYJ A;  5CY0 A;  2KGQ A;  1KAY A;  1ZVG A;  5AQP A;  1BMR A;  1BRZ A;  4AEI A;  4GNI A;  2K35 A;  2YC1 C;  1T0Z A;  3ATU A;  1ZYW A;  5AQU A;  1NRA A;  3CQX A;  1VNA A;  1NGJ A;  3QFP A;  4UAE F;  1LQQ A;  1NGE A;  1ZVE A;  3D2E A;  1PX9 A;  3FZF A;  1QQO A;  5AQQ A;  5AQN A;  2KBJ A;  5EY4 A;  2YIL A;  2LR3 A;  3L4I A;  1K8B A;  1NPI A;  3HSC A;  1S3X A;  1MYN A;  2QWN A;  3ATV A;  3LDQ A;  3GDQ A;  2E2F A;  1JXC A;  2MN5 A;  3JXU A;  1GPS A;  3AY9 A;  5KK4 A;  2GMO A;  4H5R A;  5AQS A;  1N4N A;  2NY9 X;  1SN4 A;  3CW4 A;  3PSM A;  3QML A;  1I2U A;  1BA0 A;  2JDQ D;  1NGD A;  1DJT A;  2QWL A;  3LDN A;  1UGL A;  1NGA A;  3QI7 A;  1C56 A;  5AQR A;  1ATR A;  2LKB A;  2KHO A;  1PTX A;  4KBO A;  5AQO A;  2E8A A;  3C7N B;  5EVZ A;  5AQH A;  5AQI A;  1ZYV A;  1L4V A;  1NGG A;  3GKU A;  5FPN A;  1P00 A;  1HJO A;  3FZH A;  3IUC A;  1NGF A;  1NRB A;  2N2Q A;  3R2V A;  5FPD A;  1I2V A;  5F0X A;  2YBR C;  5AR0 A;  5AQY A;  1BA1 A;  5EXW A;  3A8Y A;  4KYP A;  4AB0 A;  1NE5 A;  2E3F A;  1SN1 A;  3E7R L;  1VNB A;  1ICA A;  5F1X A;  1NGI A;  3KVG A;  3FE1 A;  1TI5 A;  2LJ7 A;  4UJ0 A;  1JKZ A;  4FL9 A;  4FSV A;  4H5T A;  1PE4 A;  4HHF A;  1C55 A;  4UAD E;  1AHO A;  2MBK A;  3D2F B;  1T7A A;  4UAF E;  1JZB A;  5AQX A;  5FPM A;  1BCG A;  1P0A A;  1OMY A;  1ZUT A;  2KJA A;  3LDO A;  3M3Z A;  2LY6 A;  3FZM A;  2SN3 A;  2LN8 A;  1WWN A;  1T1T A;  2D56 A;  1QQM A;  1NGB A;  2N66 A;  4HWI A;  1WMT A;  2KPY A;  3L6Q A;  1GPT A;  1I6G A;  1OZZ A;  2N69 A;  2B68 A;  2YIO A;  2N2R A;  2YEO A;  2MZ0 A;  1HPM A;  2LY5 A;  1ATS A;  3FZL A;  4H5N A;  5AQW A;  1B3C A;  1FH3 A;  2G2K A;  2KBH A;  1DKG D;  1LQI A;  1YUW A;  2M8B B;  2E88 A;  3D2E B;  1NGH A;  2KBK A;  1ZU3 A;  2A7T A;  1T7B A;  1T7E A;  2LI7 A;  2LT8 A;  5BN9 A;  3KOY A;  2QWM A;  3GL1 A;  3E7U X;  1ZFU A;  5AQF A;  5BPM A;  1LQH A;  1SEG A;  3KHW A;  3L56 A;  2GL1 A;  4AAZ A;  2QWO A;  4IO8 A;  2QWP A;  3C7N A;  3QFU A;  5AQM A;  3KC6 A;  4V1D C;  3KP1 A;  5AQV A;  3SF4 D;  3KOZ A;  4H5V A;  1BK8 A;  1KV0 A;  1QQN A;  5AQJ A;  1I6F A;  3LDL A;  5F2R A;  5BPN A;  1CN2 A;  5AQT A;  2I61 A;  2V7Z A;  5BPL A;  1WT7 A;  1DQ7 A;  2VY6 A;  1NGC A;  1B7D A;  2QXL A;  2E3G A;  2ASC A;  2BRZ A;  5FPE A;  1POI A;  1KAZ A;  2QWR A;  5AQZ A;  3KP0 A;  1HX1 A;  1SNB A;  2E0H A; 
#chains in the Genus database with same CATH homology
 1MR4 A;  2ATB A;  2LJM A;  2B3C A;  1CHZ A;  2KSK A;  4CQK A;  1NH5 A;  2KYQ A;  4HE7 A;  2NY8 X;  1JZA A;  1AYJ A;  5CY0 A;  2KGQ A;  1ZVG A;  1BMR A;  1BRZ A;  4AEI A;  2YC1 C;  1T0Z A;  1ZYW A;  1NRA A;  1VNA A;  1LQQ A;  1ZVE A;  1PX9 A;  2KBJ A;  2LR3 A;  1NPI A;  1MYN A;  1JXC A;  5KK4 A;  1N4N A;  2NY9 X;  1SN4 A;  3PSM A;  1I2U A;  1DJT A;  1C56 A;  2LKB A;  1PTX A;  1ZYV A;  1L4V A;  1P00 A;  1NRB A;  2N2Q A;  1I2V A;  2YBR C;  4KYP A;  4AB0 A;  1NE5 A;  2E3F A;  1SN1 A;  3E7R L;  1VNB A;  1ICA A;  1JKZ A;  1TI5 A;  2LJ7 A;  4UJ0 A;  1PE4 A;  4HHF A;  1C55 A;  1AHO A;  1T7A A;  1JZB A;  1BCG A;  1P0A A;  1OMY A;  1ZUT A;  2KJA A;  2LY6 A;  2SN3 A;  1WWN A;  1T1T A;  2N66 A;  1WMT A;  2KPY A;  1GPT A;  1I6G A;  1OZZ A;  2N69 A;  2B68 A;  2N2R A;  2YEO A;  2MZ0 A;  2LY5 A;  1B3C A;  1FH3 A;  2KBH A;  1LQI A;  2M8B B;  2KBK A;  1ZU3 A;  2A7T A;  1T7B A;  1T7E A;  2LI7 A;  2LT8 A;  3E7U X;  1ZFU A;  1GPS A;  1LQH A;  1SEG A;  4AAZ A;  2GL1 A;  4V1D C;  1BK8 A;  1KV0 A;  1CN2 A;  1I6F A;  2I61 A;  1WT7 A;  1DQ7 A;  1B7D A;  2E3G A;  2ASC A;  2BRZ A;  1SNB A;  2E0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...