1JZAA

Crystal structure of variant 2 scorpion toxin from centruroides sculpturatus ewing
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
66
structure length
66
Chain Sequence
KEGYLVNKSTGCKYGCLKLGENEGCDKECKAKNQGGSYGYCYAFACWCEGLPESTPTYPLPNKSCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of variant 2 scorpion toxin from Centruroides sculpturatus Ewing.
pubmed doi rcsb
molecule keywords NEUROTOXIN 2
molecule tags Toxin
total genus 16
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1jzaA00
1BK8A 2KPYA 2LJMA 1ZVGA 1P00A 1CHZA 2LR3A 4AEIA 2KBKA 1JZAA 2LY5A 2M8BB 1N4NA 1C55A 1LQIA 2KBHA 1B3CA 1WT7A 1T7AA 1SN4A 1VNBA 2N2RA 1OZZA 2A7TA 4HE7A 1GPTA 1MR4A 4KYPA 1DQ7A 1PX9A 2LKBA 1PTXA 2B68A 1SN1A 4HHFA 2YBRC 2KJAA 1SNBA 1NE5A 1PE4A 1GPSA 2N2QA 4CQKA 1B7DA 1JKZA 2KYQA 1ZU3A 1ICAA 1JXCA 1T0ZA 4UJ0A 1L4VA 1WWNA 1ZYWA 1JZBA 1T7BA 1BCGA 2NY8X 1T1TA 2LT8A 1OMYA 1LQHA 2E0HA 2E3GA 2KSKA 2N66A 2YC1C 2N69A 1NRBA 1DJTA 1SEGA 2YEOA 1BRZA 1I2UA 1BMRA 1C56A 1LQQA 1VNAA 4AAZA 1ZYVA 1TI5A 2BRZA 2I61A 2MZ0A 1NH5A 1KV0A 3E7RL 2LY6A 5CY0A 1I2VA 1MYNA 5KK4A 1NPIA 1WMTA 1ZUTA 1ZFUA 2E3FA 1AHOA 2SN3A 2LJ7A 1I6GA 2ATBA 4V1DC 1ZVEA 3E7UX 2KGQA 2ASCA 2NY9X 2KBJA 1FH3A 2LI7A 1AYJA 2GL1A 2B3CA 3PSMA 1CN2A 1I6FA 4AB0A 1P0AA 1T7EA 1NRAA
chains in the Genus database with same CATH superfamily
5AQQA 2E8AA 1NGGA 2QWPA 1BK8A 4UADE 2KPYA 5BN9A 2QWNA 2LJMA 1ZVGA 1P00A 2G2KA 1CHZA 2LR3A 3BK3C 5FPMA 2KHOA 4AEIA 1FH3A 3GKUA 2KBKA 1JZAA 3KP0A 5AQUA 3IUCA 2MBKA 2LY5A 2M8BB 1BUPA 1N4NA 5AQZA 3KOXA 1LQIA 5AQVA 1C55A 2KBHA 1B3CA 1WT7A 3HSCA 5FPEA 1T7AA 1SN4A 1NGFA 1VNBA 1OZZA 2A7TA 2N2RA 3FE1A 4HE7A 1GPTA 1MR4A 3ATUA 3QFUA 1HX1A 4KYPA 1NGJA 5AQGA 1DQ7A 1PX9A 4FSVA 2GMOA 2LKBA 1PTXA 1K8BA 1SN1A 2B68A 5AQTA 5BPMA 4HHFA 3R2VA 5AQJA 2YBRC 5AQOA 3KC6A 2KJAA 3LDOA 1ATSA 3LDPA 5F2RA 1KAXA 1SNBA 2QXLA 1NE5A 3FZFA 5BPLA 1PE4A 5EXWA 3CQXA 1GPSA 4KBOA 5FPNA 2N2QA 4CQKA 1B7DA 2QWOA 3D2FB 3KHWA 1BA1A 2QWQA 2E2FA 3KOWA 4UAEF 1JKZA 3D2FA 1NGHA 5AQLA 2K35A 2KYQA 1NGBA 5AQMA 2QWMA 3KOZA 1ZU3A 4H5NA 1ICAA 3QI7A 1JXCA 3I33A 1T0ZA 4UJ0A 4HWIA 1QQOA 1WWNA 1ZYWA 3D2EA 1ATRA 2MN5A 1HJOA 1L4VA 2QW9A 5BN8A 1UGLA 1JZBA 3FZHA 1KAYA 5AQNA 5AQSA 5F1XA 3KVGA 4H5WA 5AQHA 1HPMA 4FL9A 1T7BA 1BCGA 2NY8X 1T1TA 2LT8A 3FZLA 3L56A 4GNIA 3ATVA 1OMYA 1LQHA 2E0HA 2E3GA 4IO8A 5BPNA 2YIOA 3JXUA 3FZMA 1NGDA 1NGIA 2BUPA 2KSKA 2VY6A 3CW4A 2V7ZA 2N66A 2YC1C 2N69A 1NRBA 1DJTA 4H5RA 1SEGA 3SF4D 3QFPA 3GDQA 5FPDA 1NGEA 3FZKA 2YEOA 5AQRA 5AQYA 1NRAA 1BRZA 3D2EB 3L4IA 3M3ZA 2QWLA 1I2UA 3AY9A 1BMRA 2YIPA 1C56A 1LQQA 5F0XA 1VNAA 4AAZA 1ZYVA 1BA0A 1TI5A 2BRZA 2I61A 2MZ0A 5AQFA 1NH5A 1KV0A 4H5VA 5EY4A 3A8YA 3C7NB 2LY6A 3E7RL 5AQPA 3KOYA 1MYNA 5CY0A 1DKGD 1I2VA 5KK4A 1NGAA 5AQIA 3C7NA 1NPIA 1WMTA 1ZUTA 1NGCA 1ZFUA 1POIA 2E3FA 1AHOA 4UAFE 1YUWA 2LN8A 2SN3A 2LJ7A 5AQKA 5EX5A 1I6GA 2ATBA 3LDLA 5AR0A 3GL1A 2QWRA 3QMLA 3LDQA 4H5TA 4V1DC 5AQWA 1ZVEA 2JDQD 1XRSB 2KGQA 1QQNA 2ASCA 2D56A 2KBJA 2NY9X 3E7UX 2YILA 3KP1A 3LDNA 3L6QA 2LI7A 5EVZA 1KAZA 2GL1A 2B3CA 3PSMA 1AYJA 1I6FA 1CN2A 4AB0A 2E88A 5AQXA 1P0AA 1T7EA 1QQMA 1S3XA
chains in the Genus database with same CATH topology
1BK8A 2KPYA 2LJMA 1ZVGA 1P00A 1CHZA 2LR3A 4AEIA 2KBKA 1JZAA 2LY5A 2M8BB 1N4NA 1C55A 1LQIA 2KBHA 1B3CA 1WT7A 1T7AA 1SN4A 1VNBA 2N2RA 1OZZA 2A7TA 4HE7A 1GPTA 1MR4A 4KYPA 1DQ7A 1PX9A 2LKBA 1PTXA 2B68A 1SN1A 4HHFA 2YBRC 2KJAA 1SNBA 1NE5A 1PE4A 1GPSA 2N2QA 4CQKA 1B7DA 1JKZA 2KYQA 1ZU3A 1ICAA 1JXCA 1T0ZA 4UJ0A 1L4VA 1WWNA 1ZYWA 1JZBA 1T7BA 1BCGA 2NY8X 1T1TA 2LT8A 1OMYA 1LQHA 2E0HA 2E3GA 2KSKA 2N66A 2YC1C 2N69A 1NRBA 1DJTA 1SEGA 2YEOA 1BRZA 1I2UA 1BMRA 1C56A 1LQQA 1VNAA 4AAZA 1ZYVA 1TI5A 2BRZA 2I61A 2MZ0A 1NH5A 1KV0A 3E7RL 2LY6A 5CY0A 1I2VA 1MYNA 5KK4A 1NPIA 1WMTA 1ZUTA 1ZFUA 2E3FA 1AHOA 2SN3A 2LJ7A 1I6GA 2ATBA 4V1DC 1ZVEA 3E7UX 2KGQA 2ASCA 2NY9X 2KBJA 1FH3A 2LI7A 1AYJA 2GL1A 2B3CA 3PSMA 1CN2A 1I6FA 4AB0A 1P0AA 1T7EA 1NRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BK8 A;  2KPY A;  2LJM A;  1ZVG A;  1P00 A;  1CHZ A;  2LR3 A;  4AEI A;  2KBK A;  1JZA A;  2LY5 A;  2M8B B;  1N4N A;  1C55 A;  1LQI A;  2KBH A;  1B3C A;  1WT7 A;  1T7A A;  1SN4 A;  1VNB A;  2N2R A;  1OZZ A;  2A7T A;  4HE7 A;  1GPT A;  1MR4 A;  4KYP A;  1DQ7 A;  1PX9 A;  2LKB A;  1PTX A;  2B68 A;  1SN1 A;  4HHF A;  2YBR C;  2KJA A;  1SNB A;  1NE5 A;  1PE4 A;  1GPS A;  2N2Q A;  4CQK A;  1B7D A;  1JKZ A;  2KYQ A;  1ZU3 A;  1ICA A;  1JXC A;  1T0Z A;  4UJ0 A;  1L4V A;  1WWN A;  1ZYW A;  1JZB A;  1T7B A;  1BCG A;  2NY8 X;  1T1T A;  2LT8 A;  1OMY A;  1LQH A;  2E0H A;  2E3G A;  2KSK A;  2N66 A;  2YC1 C;  2N69 A;  1NRB A;  1DJT A;  1SEG A;  2YEO A;  1BRZ A;  1I2U A;  1BMR A;  1C56 A;  1LQQ A;  1VNA A;  4AAZ A;  1ZYV A;  1TI5 A;  2BRZ A;  2I61 A;  2MZ0 A;  1NH5 A;  1KV0 A;  3E7R L;  2LY6 A;  5CY0 A;  1I2V A;  1MYN A;  5KK4 A;  1NPI A;  1WMT A;  1ZUT A;  1ZFU A;  2E3F A;  1AHO A;  2SN3 A;  2LJ7 A;  1I6G A;  2ATB A;  4V1D C;  1ZVE A;  3E7U X;  2KGQ A;  2ASC A;  2NY9 X;  2KBJ A;  1FH3 A;  2LI7 A;  1AYJ A;  2GL1 A;  2B3C A;  3PSM A;  1CN2 A;  1I6F A;  4AB0 A;  1P0A A;  1T7E A;  1NRA A; 
#chains in the Genus database with same CATH topology
 5AQQ A;  2E8A A;  1NGG A;  2QWP A;  1BK8 A;  4UAD E;  2KPY A;  5BN9 A;  2QWN A;  2LJM A;  1ZVG A;  1P00 A;  2G2K A;  1CHZ A;  2LR3 A;  3BK3 C;  5FPM A;  2KHO A;  4AEI A;  1FH3 A;  3GKU A;  2KBK A;  1JZA A;  3KP0 A;  5AQU A;  3IUC A;  2MBK A;  2LY5 A;  2M8B B;  1BUP A;  1N4N A;  5AQZ A;  3KOX A;  1LQI A;  5AQV A;  1C55 A;  2KBH A;  1B3C A;  1WT7 A;  3HSC A;  5FPE A;  1T7A A;  1SN4 A;  1NGF A;  1VNB A;  1OZZ A;  2A7T A;  2N2R A;  3FE1 A;  4HE7 A;  1GPT A;  1MR4 A;  3ATU A;  3QFU A;  1HX1 A;  4KYP A;  1NGJ A;  5AQG A;  1DQ7 A;  1PX9 A;  4FSV A;  2GMO A;  2LKB A;  1PTX A;  1K8B A;  1SN1 A;  2B68 A;  5AQT A;  5BPM A;  4HHF A;  3R2V A;  5AQJ A;  2YBR C;  5AQO A;  3KC6 A;  2KJA A;  3LDO A;  1ATS A;  3LDP A;  5F2R A;  1KAX A;  1SNB A;  2QXL A;  1NE5 A;  3FZF A;  5BPL A;  1PE4 A;  5EXW A;  3CQX A;  1GPS A;  4KBO A;  5FPN A;  2N2Q A;  4CQK A;  1B7D A;  2QWO A;  3D2F B;  3KHW A;  1BA1 A;  2QWQ A;  2E2F A;  3KOW A;  4UAE F;  1JKZ A;  3D2F A;  1NGH A;  5AQL A;  2K35 A;  2KYQ A;  1NGB A;  5AQM A;  2QWM A;  3KOZ A;  1ZU3 A;  4H5N A;  1ICA A;  3QI7 A;  1JXC A;  3I33 A;  1T0Z A;  4UJ0 A;  4HWI A;  1QQO A;  1WWN A;  1ZYW A;  3D2E A;  1ATR A;  2MN5 A;  1HJO A;  1L4V A;  2QW9 A;  5BN8 A;  1UGL A;  1JZB A;  3FZH A;  1KAY A;  5AQN A;  5AQS A;  5F1X A;  3KVG A;  4H5W A;  5AQH A;  1HPM A;  4FL9 A;  1T7B A;  1BCG A;  2NY8 X;  1T1T A;  2LT8 A;  3FZL A;  3L56 A;  4GNI A;  3ATV A;  1OMY A;  1LQH A;  2E0H A;  2E3G A;  4IO8 A;  5BPN A;  2YIO A;  3JXU A;  3FZM A;  1NGD A;  1NGI A;  2BUP A;  2KSK A;  2VY6 A;  3CW4 A;  2V7Z A;  2N66 A;  2YC1 C;  2N69 A;  1NRB A;  1DJT A;  4H5R A;  1SEG A;  3SF4 D;  3QFP A;  3GDQ A;  5FPD A;  1NGE A;  3FZK A;  2YEO A;  5AQR A;  5AQY A;  1NRA A;  1BRZ A;  3D2E B;  3L4I A;  3M3Z A;  2QWL A;  1I2U A;  3AY9 A;  1BMR A;  2YIP A;  1C56 A;  1LQQ A;  5F0X A;  1VNA A;  4AAZ A;  1ZYV A;  1BA0 A;  1TI5 A;  2BRZ A;  2I61 A;  2MZ0 A;  5AQF A;  1NH5 A;  1KV0 A;  4H5V A;  5EY4 A;  3A8Y A;  3C7N B;  2LY6 A;  3E7R L;  5AQP A;  3KOY A;  1MYN A;  5CY0 A;  1DKG D;  1I2V A;  5KK4 A;  1NGA A;  5AQI A;  3C7N A;  1NPI A;  1WMT A;  1ZUT A;  1NGC A;  1ZFU A;  1POI A;  2E3F A;  1AHO A;  4UAF E;  1YUW A;  2LN8 A;  2SN3 A;  2LJ7 A;  5AQK A;  5EX5 A;  1I6G A;  2ATB A;  3LDL A;  5AR0 A;  3GL1 A;  2QWR A;  3QML A;  3LDQ A;  4H5T A;  4V1D C;  5AQW A;  1ZVE A;  2JDQ D;  1XRS B;  2KGQ A;  1QQN A;  2ASC A;  2D56 A;  2KBJ A;  2NY9 X;  3E7U X;  2YIL A;  3KP1 A;  3LDN A;  3L6Q A;  2LI7 A;  5EVZ A;  1KAZ A;  2GL1 A;  2B3C A;  3PSM A;  1AYJ A;  1I6F A;  1CN2 A;  4AB0 A;  2E88 A;  5AQX A;  1P0A A;  1T7E A;  1QQM A;  1S3X A; 
#chains in the Genus database with same CATH homology
 1BK8 A;  2KPY A;  2LJM A;  1ZVG A;  1P00 A;  1CHZ A;  2LR3 A;  4AEI A;  2KBK A;  1JZA A;  2LY5 A;  2M8B B;  1N4N A;  1C55 A;  1LQI A;  2KBH A;  1B3C A;  1WT7 A;  1T7A A;  1SN4 A;  1VNB A;  2N2R A;  1OZZ A;  2A7T A;  4HE7 A;  1GPT A;  1MR4 A;  4KYP A;  1DQ7 A;  1PX9 A;  2LKB A;  1PTX A;  2B68 A;  1SN1 A;  4HHF A;  2YBR C;  2KJA A;  1SNB A;  1NE5 A;  1PE4 A;  1GPS A;  2N2Q A;  4CQK A;  1B7D A;  1JKZ A;  2KYQ A;  1ZU3 A;  1ICA A;  1JXC A;  1T0Z A;  4UJ0 A;  1L4V A;  1WWN A;  1ZYW A;  1JZB A;  1T7B A;  1BCG A;  2NY8 X;  1T1T A;  2LT8 A;  1OMY A;  1LQH A;  2E0H A;  2E3G A;  2KSK A;  2N66 A;  2YC1 C;  2N69 A;  1NRB A;  1DJT A;  1SEG A;  2YEO A;  1BRZ A;  1I2U A;  1BMR A;  1C56 A;  1LQQ A;  1VNA A;  4AAZ A;  1ZYV A;  1TI5 A;  2BRZ A;  2I61 A;  2MZ0 A;  1NH5 A;  1KV0 A;  3E7R L;  2LY6 A;  5CY0 A;  1I2V A;  1MYN A;  5KK4 A;  1NPI A;  1WMT A;  1ZUT A;  1ZFU A;  2E3F A;  1AHO A;  2SN3 A;  2LJ7 A;  1I6G A;  2ATB A;  4V1D C;  1ZVE A;  3E7U X;  2KGQ A;  2ASC A;  2NY9 X;  2KBJ A;  1FH3 A;  2LI7 A;  1AYJ A;  2GL1 A;  2B3C A;  3PSM A;  1CN2 A;  1I6F A;  4AB0 A;  1P0A A;  1T7E A;  1NRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...