1JZAA

Crystal structure of variant 2 scorpion toxin from centruroides sculpturatus ewing
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
66
structure length
66
Chain Sequence
KEGYLVNKSTGCKYGCLKLGENEGCDKECKAKNQGGSYGYCYAFACWCEGLPESTPTYPLPNKSCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROTOXIN 2
publication title Structure of variant 2 scorpion toxin from Centruroides sculpturatus Ewing.
pubmed doi rcsb
molecule tags Toxin
total genus 16
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1jzaA00
1C55A 1CN2A 1T1TA 1MR4A 1JKZA 1AYJA 2LKBA 1ZVGA 2ASCA 1SN4A 1WWNA 2N66A 1I6GA 1DQ7A 4CQKA 2E3FA 4AEIA 1OZZA 2KGQA 2SN3A 4HHFA 1VNAA 2B3CA 2KBHA 3PSMA 1ZYWA 1FH3A 1VNBA 1AHOA 2KYQA 1SN1A 1NPIA 2NY9X 2A7TA 2NY8X 1P00A 1JZAA 1DJTA 1ZYVA 2ATBA 1NRBA 4HE7A 1TI5A 1T0ZA 2LY5A 4AAZA 1JXCA 1WT7A 1P0AA 2MZ0A 1B3CA 1NRAA 1L4VA 1I6FA 1JZBA 1BRZA 1PX9A 2N2QA 2KPYA 1I2UA 1OMYA 1T7EA 1GPTA 1ICAA 1ZUTA 1T7AA 2YC1C 1ZVEA 1LQIA 1I2VA 2GL1A 1KV0A 4KYPA 2KSKA 5CY0A 2YEOA 2N2RA 1LQHA 1BCGA 2LY6A 1NH5A 2B68A 2LR3A 5KK4A 1B7DA 2KBJA 2E0HA 1PE4A 4AB0A 4UJ0A 1SEGA 1SNBA 1CHZA 1MYNA 1C56A 1NE5A 1T7BA 1ZFUA 3E7RL 1BMRA 1LQQA 1N4NA 2KJAA 1PTXA 2LJMA 2LJ7A 1GPSA 1BK8A 1ZU3A 2YBRC 2E3GA 3E7UX 2N69A 2KBKA 1WMTA 2BRZA 2LT8A 2M8BB 2LI7A 4V1DC 2I61A
chains in the Genus database with same CATH superfamily
1C55A 3KOXA 1CN2A 1T1TA 1MR4A 1JKZA 1XRSB 1AYJA 3KP0A 2LKBA 1ZVGA 2ASCA 5BN8A 4KBOA 1SN4A 1WWNA 2N66A 1BUPA 1DQ7A 1I6GA 1QQNA 4CQKA 2E3FA 2QWLA 4UAFE 4AEIA 1OZZA 2KGQA 2SN3A 5AQNA 3FZLA 5FPEA 2GMOA 4HHFA 1VNAA 1NGHA 2B3CA 1BA0A 2KBHA 2V7ZA 1HX1A 3PSMA 1ZYWA 3LDPA 3SF4D 2JDQD 5BPLA 1VNBA 2YILA 3L6QA 1FH3A 1AHOA 1POIA 5AQPA 2KYQA 1SN1A 1NPIA 2QWNA 5AQIA 4H5NA 2NY9X 3LDNA 1KAYA 1DKGD 2A7TA 2E2FA 3FZMA 2NY8X 3QI7A 1YUWA 1KAZA 1P00A 2K35A 5F0XA 1JZAA 3LDQA 1DJTA 1ZYVA 2ATBA 1NGAA 3A8YA 5AQQA 1NRBA 4HE7A 1TI5A 2QWRA 1T0ZA 2LY5A 5AQHA 4AAZA 1JXCA 5AQKA 1WT7A 1P0AA 2MZ0A 3AY9A 3BK3C 1B3CA 3ATVA 1NRAA 3R2VA 1QQOA 1I6FA 1NGJA 1L4VA 2YIOA 3D2FA 1NGCA 1JZBA 1BA1A 1BRZA 5AQTA 3FZFA 5EX5A 5AQJA 1PX9A 4H5TA 2N2QA 3KOYA 5AQYA 2KPYA 1I2UA 3QFPA 1OMYA 3LDOA 5BPMA 5AQGA 1NGGA 1NGDA 4H5RA 1T7EA 3D2EA 3IUCA 4FSVA 1GPTA 5BN9A 2E88A 1ICAA 1ZUTA 5EVZA 1T7AA 5AQXA 1S3XA 3CW4A 1NGIA 2YC1C 3GL1A 1UGLA 1ZVEA 3KOZA 2G2KA 3KP1A 2KHOA 5AQMA 1LQIA 2QWPA 2QWOA 3KHWA 3CQXA 5F2RA 2LN8A 2E8AA 4IO8A 2YIPA 3D2EB 2QWQA 1I2VA 3GDQA 3L56A 4FL9A 4UAEF 2GL1A 3GKUA 4GNIA 1KV0A 3FZKA 3M3ZA 2QW9A 4KYPA 2KSKA 5CY0A 2YEOA 3KOWA 2N2RA 1K8BA 5AQFA 1LQHA 1BCGA 1NGBA 2LY6A 1NGFA 1NH5A 5AQVA 2MBKA 2D56A 5F1XA 2B68A 1KAXA 2LR3A 2VY6A 5KK4A 1B7DA 2KBJA 5AQUA 5FPDA 2E0HA 5EY4A 4H5VA 3QFUA 1PE4A 5AR0A 4AB0A 4UJ0A 1ATRA 1SEGA 1CHZA 1MYNA 1SNBA 3D2FB 1C56A 1NE5A 1T7BA 2MN5A 3KC6A 5AQSA 5FPNA 5BPNA 4HWIA 3QMLA 5AQLA 1ZFUA 3E7RL 3LDLA 2QWMA 1BMRA 1LQQA 3FZHA 1N4NA 2KJAA 1PTXA 2LJMA 3KVGA 5AQZA 5AQWA 2LJ7A 1GPSA 1HPMA 3JXUA 1BK8A 1ZU3A 1QQMA 3ATUA 3C7NA 3L4IA 2BUPA 2YBRC 1ATSA 1NGEA 2E3GA 3E7UX 4UADE 3HSCA 2N69A 2KBKA 5FPMA 3I33A 1WMTA 1HJOA 3FE1A 2BRZA 4H5WA 2LT8A 2M8BB 5AQRA 2LI7A 3C7NB 5EXWA 4V1DC 5AQOA 2QXLA 2I61A
chains in the Genus database with same CATH topology
1C55A 1CN2A 1T1TA 1MR4A 1JKZA 1AYJA 2LKBA 1ZVGA 2ASCA 1SN4A 1WWNA 2N66A 1I6GA 1DQ7A 4CQKA 2E3FA 4AEIA 1OZZA 2KGQA 2SN3A 4HHFA 1VNAA 2B3CA 2KBHA 3PSMA 1ZYWA 1FH3A 1VNBA 1AHOA 2KYQA 1SN1A 1NPIA 2NY9X 2A7TA 2NY8X 1P00A 1JZAA 1DJTA 1ZYVA 2ATBA 1NRBA 4HE7A 1TI5A 1T0ZA 2LY5A 4AAZA 1JXCA 1WT7A 1P0AA 2MZ0A 1B3CA 1NRAA 1L4VA 1I6FA 1JZBA 1BRZA 1PX9A 2N2QA 2KPYA 1I2UA 1OMYA 1T7EA 1GPTA 1ICAA 1ZUTA 1T7AA 2YC1C 1ZVEA 1LQIA 1I2VA 2GL1A 1KV0A 4KYPA 2KSKA 5CY0A 2YEOA 2N2RA 1LQHA 1BCGA 2LY6A 1NH5A 2B68A 2LR3A 5KK4A 1B7DA 2KBJA 2E0HA 1PE4A 4AB0A 4UJ0A 1SEGA 1SNBA 1CHZA 1MYNA 1C56A 1NE5A 1T7BA 1ZFUA 3E7RL 1BMRA 1LQQA 1N4NA 2KJAA 1PTXA 2LJMA 2LJ7A 1GPSA 1BK8A 1ZU3A 2YBRC 2E3GA 3E7UX 2N69A 2KBKA 1WMTA 2BRZA 2LT8A 2M8BB 2LI7A 4V1DC 2I61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C55 A;  1CN2 A;  1T1T A;  1MR4 A;  1JKZ A;  1AYJ A;  2LKB A;  1ZVG A;  2ASC A;  1SN4 A;  1WWN A;  2N66 A;  1I6G A;  1DQ7 A;  4CQK A;  2E3F A;  4AEI A;  1OZZ A;  2KGQ A;  2SN3 A;  4HHF A;  1VNA A;  2B3C A;  2KBH A;  3PSM A;  1ZYW A;  1FH3 A;  1VNB A;  1AHO A;  2KYQ A;  1SN1 A;  1NPI A;  2NY9 X;  2A7T A;  2NY8 X;  1P00 A;  1JZA A;  1DJT A;  1ZYV A;  2ATB A;  1NRB A;  4HE7 A;  1TI5 A;  1T0Z A;  2LY5 A;  4AAZ A;  1JXC A;  1WT7 A;  1P0A A;  2MZ0 A;  1B3C A;  1NRA A;  1L4V A;  1I6F A;  1JZB A;  1BRZ A;  1PX9 A;  2N2Q A;  2KPY A;  1I2U A;  1OMY A;  1T7E A;  1GPT A;  1ICA A;  1ZUT A;  1T7A A;  2YC1 C;  1ZVE A;  1LQI A;  1I2V A;  2GL1 A;  1KV0 A;  4KYP A;  2KSK A;  5CY0 A;  2YEO A;  2N2R A;  1LQH A;  1BCG A;  2LY6 A;  1NH5 A;  2B68 A;  2LR3 A;  5KK4 A;  1B7D A;  2KBJ A;  2E0H A;  1PE4 A;  4AB0 A;  4UJ0 A;  1SEG A;  1SNB A;  1CHZ A;  1MYN A;  1C56 A;  1NE5 A;  1T7B A;  1ZFU A;  3E7R L;  1BMR A;  1LQQ A;  1N4N A;  2KJA A;  1PTX A;  2LJM A;  2LJ7 A;  1GPS A;  1BK8 A;  1ZU3 A;  2YBR C;  2E3G A;  3E7U X;  2N69 A;  2KBK A;  1WMT A;  2BRZ A;  2LT8 A;  2M8B B;  2LI7 A;  4V1D C;  2I61 A; 
#chains in the Genus database with same CATH topology
 1C55 A;  3KOX A;  1CN2 A;  1T1T A;  1MR4 A;  1JKZ A;  1XRS B;  1AYJ A;  3KP0 A;  2LKB A;  1ZVG A;  2ASC A;  5BN8 A;  4KBO A;  1SN4 A;  1WWN A;  2N66 A;  1BUP A;  1DQ7 A;  1I6G A;  1QQN A;  4CQK A;  2E3F A;  2QWL A;  4UAF E;  4AEI A;  1OZZ A;  2KGQ A;  2SN3 A;  5AQN A;  3FZL A;  5FPE A;  2GMO A;  4HHF A;  1VNA A;  1NGH A;  2B3C A;  1BA0 A;  2KBH A;  2V7Z A;  1HX1 A;  3PSM A;  1ZYW A;  3LDP A;  3SF4 D;  2JDQ D;  5BPL A;  1VNB A;  2YIL A;  3L6Q A;  1FH3 A;  1AHO A;  1POI A;  5AQP A;  2KYQ A;  1SN1 A;  1NPI A;  2QWN A;  5AQI A;  4H5N A;  2NY9 X;  3LDN A;  1KAY A;  1DKG D;  2A7T A;  2E2F A;  3FZM A;  2NY8 X;  3QI7 A;  1YUW A;  1KAZ A;  1P00 A;  2K35 A;  5F0X A;  1JZA A;  3LDQ A;  1DJT A;  1ZYV A;  2ATB A;  1NGA A;  3A8Y A;  5AQQ A;  1NRB A;  4HE7 A;  1TI5 A;  2QWR A;  1T0Z A;  2LY5 A;  5AQH A;  4AAZ A;  1JXC A;  5AQK A;  1WT7 A;  1P0A A;  2MZ0 A;  3AY9 A;  3BK3 C;  1B3C A;  3ATV A;  1NRA A;  3R2V A;  1QQO A;  1I6F A;  1NGJ A;  1L4V A;  2YIO A;  3D2F A;  1NGC A;  1JZB A;  1BA1 A;  1BRZ A;  5AQT A;  3FZF A;  5EX5 A;  5AQJ A;  1PX9 A;  4H5T A;  2N2Q A;  3KOY A;  5AQY A;  2KPY A;  1I2U A;  3QFP A;  1OMY A;  3LDO A;  5BPM A;  5AQG A;  1NGG A;  1NGD A;  4H5R A;  1T7E A;  3D2E A;  3IUC A;  4FSV A;  1GPT A;  5BN9 A;  2E88 A;  1ICA A;  1ZUT A;  5EVZ A;  1T7A A;  5AQX A;  1S3X A;  3CW4 A;  1NGI A;  2YC1 C;  3GL1 A;  1UGL A;  1ZVE A;  3KOZ A;  2G2K A;  3KP1 A;  2KHO A;  5AQM A;  1LQI A;  2QWP A;  2QWO A;  3KHW A;  3CQX A;  5F2R A;  2LN8 A;  2E8A A;  4IO8 A;  2YIP A;  3D2E B;  2QWQ A;  1I2V A;  3GDQ A;  3L56 A;  4FL9 A;  4UAE F;  2GL1 A;  3GKU A;  4GNI A;  1KV0 A;  3FZK A;  3M3Z A;  2QW9 A;  4KYP A;  2KSK A;  5CY0 A;  2YEO A;  3KOW A;  2N2R A;  1K8B A;  5AQF A;  1LQH A;  1BCG A;  1NGB A;  2LY6 A;  1NGF A;  1NH5 A;  5AQV A;  2MBK A;  2D56 A;  5F1X A;  2B68 A;  1KAX A;  2LR3 A;  2VY6 A;  5KK4 A;  1B7D A;  2KBJ A;  5AQU A;  5FPD A;  2E0H A;  5EY4 A;  4H5V A;  3QFU A;  1PE4 A;  5AR0 A;  4AB0 A;  4UJ0 A;  1ATR A;  1SEG A;  1CHZ A;  1MYN A;  1SNB A;  3D2F B;  1C56 A;  1NE5 A;  1T7B A;  2MN5 A;  3KC6 A;  5AQS A;  5FPN A;  5BPN A;  4HWI A;  3QML A;  5AQL A;  1ZFU A;  3E7R L;  3LDL A;  2QWM A;  1BMR A;  1LQQ A;  3FZH A;  1N4N A;  2KJA A;  1PTX A;  2LJM A;  3KVG A;  5AQZ A;  5AQW A;  2LJ7 A;  1GPS A;  1HPM A;  3JXU A;  1BK8 A;  1ZU3 A;  1QQM A;  3ATU A;  3C7N A;  3L4I A;  2BUP A;  2YBR C;  1ATS A;  1NGE A;  2E3G A;  3E7U X;  4UAD E;  3HSC A;  2N69 A;  2KBK A;  5FPM A;  3I33 A;  1WMT A;  1HJO A;  3FE1 A;  2BRZ A;  4H5W A;  2LT8 A;  2M8B B;  5AQR A;  2LI7 A;  3C7N B;  5EXW A;  4V1D C;  5AQO A;  2QXL A;  2I61 A; 
#chains in the Genus database with same CATH homology
 1C55 A;  1CN2 A;  1T1T A;  1MR4 A;  1JKZ A;  1AYJ A;  2LKB A;  1ZVG A;  2ASC A;  1SN4 A;  1WWN A;  2N66 A;  1I6G A;  1DQ7 A;  4CQK A;  2E3F A;  4AEI A;  1OZZ A;  2KGQ A;  2SN3 A;  4HHF A;  1VNA A;  2B3C A;  2KBH A;  3PSM A;  1ZYW A;  1FH3 A;  1VNB A;  1AHO A;  2KYQ A;  1SN1 A;  1NPI A;  2NY9 X;  2A7T A;  2NY8 X;  1P00 A;  1JZA A;  1DJT A;  1ZYV A;  2ATB A;  1NRB A;  4HE7 A;  1TI5 A;  1T0Z A;  2LY5 A;  4AAZ A;  1JXC A;  1WT7 A;  1P0A A;  2MZ0 A;  1B3C A;  1NRA A;  1L4V A;  1I6F A;  1JZB A;  1BRZ A;  1PX9 A;  2N2Q A;  2KPY A;  1I2U A;  1OMY A;  1T7E A;  1GPT A;  1ICA A;  1ZUT A;  1T7A A;  2YC1 C;  1ZVE A;  1LQI A;  1I2V A;  2GL1 A;  1KV0 A;  4KYP A;  2KSK A;  5CY0 A;  2YEO A;  2N2R A;  1LQH A;  1BCG A;  2LY6 A;  1NH5 A;  2B68 A;  2LR3 A;  5KK4 A;  1B7D A;  2KBJ A;  2E0H A;  1PE4 A;  4AB0 A;  4UJ0 A;  1SEG A;  1SNB A;  1CHZ A;  1MYN A;  1C56 A;  1NE5 A;  1T7B A;  1ZFU A;  3E7R L;  1BMR A;  1LQQ A;  1N4N A;  2KJA A;  1PTX A;  2LJM A;  2LJ7 A;  1GPS A;  1BK8 A;  1ZU3 A;  2YBR C;  2E3G A;  3E7U X;  2N69 A;  2KBK A;  1WMT A;  2BRZ A;  2LT8 A;  2M8B B;  2LI7 A;  4V1D C;  2I61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...