2SN3A

Structure of scorpion toxin variant-3 at 1.2 angstroms resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
65
structure length
65
Chain Sequence
KEGYLVKKSDGCKYGCLKLGENEGCDTECKAKNQGGSYGYCYAFACWCEGLPESTPTYPLPNKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of scorpion toxin variant-3 at 1.2 A resolution.
pubmed doi rcsb
molecule keywords SCORPION NEUROTOXIN (VARIANT 3)
molecule tags Toxin
source organism Centruroides exilicauda
total genus 17
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1992-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2sn3A00
1C55A 1GPTA 1ZYWA 1L4VA 1JXCA 2B3CA 2KSKA 1SN1A 1WWNA 1AYJA 2MZ0A 2N66A 1BRZA 2ASCA 1NRAA 2LJMA 1I6GA 1ZU3A 1T7BA 1BMRA 2ATBA 1AHOA 2KPYA 1LQQA 1C56A 1P0AA 2KJAA 5KK4A 1T7AA 1BK8A 1P00A 1NRBA 2YEOA 1JZAA 2BRZA 2E3GA 1MR4A 1N4NA 2M8BB 2E3FA 1PTXA 2N69A 2SN3A 1T7EA 4HE7A 1I6FA 4AEIA 1SEGA 2YC1C 2LR3A 2LI7A 1T0ZA 1PE4A 4HHFA 1OZZA 5CY0A 2KGQA 1VNAA 1TI5A 2KBJA 1SNBA 1T1TA 1ZFUA 1ZVGA 2B68A 2LKBA 2LY5A 2KYQA 1WT7A 1BCGA 1NE5A 2N2QA 3PSMA 1OMYA 3E7RL 4V1DC 1PX9A 1I2UA 1KV0A 1GPSA 1ZYVA 4CQKA 1LQHA 1NH5A 2KBKA 1B3CA 1LQIA 2LJ7A 3E7UX 2LY6A 2YBRC 1FH3A 1DQ7A 4AB0A 2GL1A 1NPIA 1MYNA 4UJ0A 1JZBA 1DJTA 2LT8A 2N2RA 2NY9X 1CN2A 1ZUTA 1ZVEA 4KYPA 2I61A 1SN4A 1VNBA 1ICAA 1B7DA 2KBHA 1I2VA 1WMTA 2A7TA 2E0HA 2NY8X 1JKZA 1CHZA 4AAZA
chains in the Genus database with same CATH superfamily
1NGJA 4UAEF 3FZKA 2V7ZA 4UAFE 1C55A 1ZYWA 1GPTA 2QWOA 3FE1A 1L4VA 1JXCA 5AQKA 2B3CA 2KSKA 5BPLA 3C7NA 5BN9A 5AQIA 1BA0A 1SN1A 1WWNA 4H5RA 2MZ0A 1AYJA 1YUWA 1BA1A 2N66A 1BRZA 5EX5A 2ASCA 3LDNA 1KAYA 1NRAA 2LJMA 4H5NA 1I6GA 1HX1A 1T7BA 1ZU3A 5AQYA 1BMRA 3LDPA 2ATBA 1AHOA 2KPYA 1XRSB 1LQQA 1C56A 3D2EB 1HPMA 1P0AA 2KJAA 1QQNA 3C7NB 1NGBA 1T7AA 5KK4A 5AQMA 4H5VA 1BK8A 1NGDA 1P00A 5BPNA 1NRBA 5AQJA 2YEOA 1JZAA 2BRZA 2E3GA 1MR4A 1N4NA 2BUPA 2M8BB 2QWLA 3D2FA 2KHOA 2E3FA 1NGFA 3KOZA 2E88A 3I33A 1PTXA 1KAZA 3L6QA 2N69A 2GMOA 2SN3A 2JDQD 1T7EA 5BPMA 5AQGA 2G2KA 2E8AA 4HE7A 4HWIA 4UADE 1I6FA 5AR0A 4AEIA 5AQPA 5AQNA 5FPMA 3FZHA 1SEGA 2YC1C 2E2FA 3KHWA 2LR3A 3A8YA 3KP1A 2LI7A 3LDLA 1T0ZA 3JXUA 5EVZA 3SF4D 1PE4A 2MBKA 4GNIA 1QQMA 4HHFA 5AQTA 2QWPA 3M3ZA 1OZZA 5FPDA 5CY0A 2KGQA 1VNAA 1TI5A 3LDQA 2KBJA 1SNBA 1T1TA 1ZFUA 1ZVGA 1HJOA 2B68A 2LKBA 2LN8A 2LY5A 2QXLA 3ATVA 3QMLA 3LDOA 3KVGA 1KAXA 1UGLA 2KYQA 5F1XA 1WT7A 4IO8A 3R2VA 1K8BA 1BCGA 1NE5A 4FL9A 3QFUA 2YIOA 4FSVA 2N2QA 3PSMA 3ATUA 2QWRA 4H5TA 1OMYA 1NGIA 3QI7A 5AQUA 5EXWA 1POIA 3E7RL 1ATSA 3GL1A 4V1DC 1PX9A 3KC6A 3KOXA 2D56A 1KV0A 3L56A 1I2UA 2MN5A 5AQOA 3FZFA 3QFPA 5AQQA 1ZYVA 5AQSA 3GKUA 5FPNA 1GPSA 3KP0A 1NGEA 3KOWA 4CQKA 5FPEA 1LQHA 1NH5A 3D2FB 5F0XA 3IUCA 5F2RA 2KBKA 1B3CA 3D2EA 1LQIA 5AQZA 2YILA 2QW9A 2LJ7A 3E7UX 2LY6A 2YBRC 1FH3A 1DQ7A 4AB0A 2QWNA 2QWMA 2GL1A 1ATRA 1NPIA 1MYNA 5AQFA 5AQLA 5AQVA 4UJ0A 1NGGA 5EY4A 2YIPA 1NGAA 2QWQA 1BUPA 3KOYA 3FZLA 4KBOA 1JZBA 1DJTA 2LT8A 2N2RA 1NGHA 3CW4A 2NY9X 3FZMA 5AQHA 5AQWA 1QQOA 1CN2A 1ZUTA 1ZVEA 3AY9A 4KYPA 1S3XA 4H5WA 5AQXA 3GDQA 2I61A 3BK3C 1SN4A 3HSCA 2K35A 1DKGD 5BN8A 1VNBA 1ICAA 1B7DA 2KBHA 3L4IA 1WMTA 2A7TA 1I2VA 3CQXA 2E0HA 2NY8X 5AQRA 2VY6A 1JKZA 1CHZA 1NGCA 4AAZA
chains in the Genus database with same CATH topology
1C55A 1GPTA 1ZYWA 1L4VA 1JXCA 2B3CA 2KSKA 1SN1A 1WWNA 1AYJA 2MZ0A 2N66A 1BRZA 2ASCA 1NRAA 2LJMA 1I6GA 1ZU3A 1T7BA 1BMRA 2ATBA 1AHOA 2KPYA 1LQQA 1C56A 1P0AA 2KJAA 5KK4A 1T7AA 1BK8A 1P00A 1NRBA 2YEOA 1JZAA 2BRZA 2E3GA 1MR4A 1N4NA 2M8BB 2E3FA 1PTXA 2N69A 2SN3A 1T7EA 4HE7A 1I6FA 4AEIA 1SEGA 2YC1C 2LR3A 2LI7A 1T0ZA 1PE4A 4HHFA 1OZZA 5CY0A 2KGQA 1VNAA 1TI5A 2KBJA 1SNBA 1T1TA 1ZFUA 1ZVGA 2B68A 2LKBA 2LY5A 2KYQA 1WT7A 1BCGA 1NE5A 2N2QA 3PSMA 1OMYA 3E7RL 4V1DC 1PX9A 1I2UA 1KV0A 1GPSA 1ZYVA 4CQKA 1LQHA 1NH5A 2KBKA 1B3CA 1LQIA 2LJ7A 3E7UX 2LY6A 2YBRC 1FH3A 1DQ7A 4AB0A 2GL1A 1NPIA 1MYNA 4UJ0A 1JZBA 1DJTA 2LT8A 2N2RA 2NY9X 1CN2A 1ZUTA 1ZVEA 4KYPA 2I61A 1SN4A 1VNBA 1ICAA 1B7DA 2KBHA 1I2VA 1WMTA 2A7TA 2E0HA 2NY8X 1JKZA 1CHZA 4AAZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C55 A;  1GPT A;  1ZYW A;  1L4V A;  1JXC A;  2B3C A;  2KSK A;  1SN1 A;  1WWN A;  1AYJ A;  2MZ0 A;  2N66 A;  1BRZ A;  2ASC A;  1NRA A;  2LJM A;  1I6G A;  1ZU3 A;  1T7B A;  1BMR A;  2ATB A;  1AHO A;  2KPY A;  1LQQ A;  1C56 A;  1P0A A;  2KJA A;  5KK4 A;  1T7A A;  1BK8 A;  1P00 A;  1NRB A;  2YEO A;  1JZA A;  2BRZ A;  2E3G A;  1MR4 A;  1N4N A;  2M8B B;  2E3F A;  1PTX A;  2N69 A;  2SN3 A;  1T7E A;  4HE7 A;  1I6F A;  4AEI A;  1SEG A;  2YC1 C;  2LR3 A;  2LI7 A;  1T0Z A;  1PE4 A;  4HHF A;  1OZZ A;  5CY0 A;  2KGQ A;  1VNA A;  1TI5 A;  2KBJ A;  1SNB A;  1T1T A;  1ZFU A;  1ZVG A;  2B68 A;  2LKB A;  2LY5 A;  2KYQ A;  1WT7 A;  1BCG A;  1NE5 A;  2N2Q A;  3PSM A;  1OMY A;  3E7R L;  4V1D C;  1PX9 A;  1I2U A;  1KV0 A;  1GPS A;  1ZYV A;  4CQK A;  1LQH A;  1NH5 A;  2KBK A;  1B3C A;  1LQI A;  2LJ7 A;  3E7U X;  2LY6 A;  2YBR C;  1FH3 A;  1DQ7 A;  4AB0 A;  2GL1 A;  1NPI A;  1MYN A;  4UJ0 A;  1JZB A;  1DJT A;  2LT8 A;  2N2R A;  2NY9 X;  1CN2 A;  1ZUT A;  1ZVE A;  4KYP A;  2I61 A;  1SN4 A;  1VNB A;  1ICA A;  1B7D A;  2KBH A;  1I2V A;  1WMT A;  2A7T A;  2E0H A;  2NY8 X;  1JKZ A;  1CHZ A;  4AAZ A; 
#chains in the Genus database with same CATH topology
 1NGJ A;  4UAE F;  3FZK A;  2V7Z A;  4UAF E;  1C55 A;  1ZYW A;  1GPT A;  2QWO A;  3FE1 A;  1L4V A;  1JXC A;  5AQK A;  2B3C A;  2KSK A;  5BPL A;  3C7N A;  5BN9 A;  5AQI A;  1BA0 A;  1SN1 A;  1WWN A;  4H5R A;  2MZ0 A;  1AYJ A;  1YUW A;  1BA1 A;  2N66 A;  1BRZ A;  5EX5 A;  2ASC A;  3LDN A;  1KAY A;  1NRA A;  2LJM A;  4H5N A;  1I6G A;  1HX1 A;  1T7B A;  1ZU3 A;  5AQY A;  1BMR A;  3LDP A;  2ATB A;  1AHO A;  2KPY A;  1XRS B;  1LQQ A;  1C56 A;  3D2E B;  1HPM A;  1P0A A;  2KJA A;  1QQN A;  3C7N B;  1NGB A;  1T7A A;  5KK4 A;  5AQM A;  4H5V A;  1BK8 A;  1NGD A;  1P00 A;  5BPN A;  1NRB A;  5AQJ A;  2YEO A;  1JZA A;  2BRZ A;  2E3G A;  1MR4 A;  1N4N A;  2BUP A;  2M8B B;  2QWL A;  3D2F A;  2KHO A;  2E3F A;  1NGF A;  3KOZ A;  2E88 A;  3I33 A;  1PTX A;  1KAZ A;  3L6Q A;  2N69 A;  2GMO A;  2SN3 A;  2JDQ D;  1T7E A;  5BPM A;  5AQG A;  2G2K A;  2E8A A;  4HE7 A;  4HWI A;  4UAD E;  1I6F A;  5AR0 A;  4AEI A;  5AQP A;  5AQN A;  5FPM A;  3FZH A;  1SEG A;  2YC1 C;  2E2F A;  3KHW A;  2LR3 A;  3A8Y A;  3KP1 A;  2LI7 A;  3LDL A;  1T0Z A;  3JXU A;  5EVZ A;  3SF4 D;  1PE4 A;  2MBK A;  4GNI A;  1QQM A;  4HHF A;  5AQT A;  2QWP A;  3M3Z A;  1OZZ A;  5FPD A;  5CY0 A;  2KGQ A;  1VNA A;  1TI5 A;  3LDQ A;  2KBJ A;  1SNB A;  1T1T A;  1ZFU A;  1ZVG A;  1HJO A;  2B68 A;  2LKB A;  2LN8 A;  2LY5 A;  2QXL A;  3ATV A;  3QML A;  3LDO A;  3KVG A;  1KAX A;  1UGL A;  2KYQ A;  5F1X A;  1WT7 A;  4IO8 A;  3R2V A;  1K8B A;  1BCG A;  1NE5 A;  4FL9 A;  3QFU A;  2YIO A;  4FSV A;  2N2Q A;  3PSM A;  3ATU A;  2QWR A;  4H5T A;  1OMY A;  1NGI A;  3QI7 A;  5AQU A;  5EXW A;  1POI A;  3E7R L;  1ATS A;  3GL1 A;  4V1D C;  1PX9 A;  3KC6 A;  3KOX A;  2D56 A;  1KV0 A;  3L56 A;  1I2U A;  2MN5 A;  5AQO A;  3FZF A;  3QFP A;  5AQQ A;  1ZYV A;  5AQS A;  3GKU A;  5FPN A;  1GPS A;  3KP0 A;  1NGE A;  3KOW A;  4CQK A;  5FPE A;  1LQH A;  1NH5 A;  3D2F B;  5F0X A;  3IUC A;  5F2R A;  2KBK A;  1B3C A;  3D2E A;  1LQI A;  5AQZ A;  2YIL A;  2QW9 A;  2LJ7 A;  3E7U X;  2LY6 A;  2YBR C;  1FH3 A;  1DQ7 A;  4AB0 A;  2QWN A;  2QWM A;  2GL1 A;  1ATR A;  1NPI A;  1MYN A;  5AQF A;  5AQL A;  5AQV A;  4UJ0 A;  1NGG A;  5EY4 A;  2YIP A;  1NGA A;  2QWQ A;  1BUP A;  3KOY A;  3FZL A;  4KBO A;  1JZB A;  1DJT A;  2LT8 A;  2N2R A;  1NGH A;  3CW4 A;  2NY9 X;  3FZM A;  5AQH A;  5AQW A;  1QQO A;  1CN2 A;  1ZUT A;  1ZVE A;  3AY9 A;  4KYP A;  1S3X A;  4H5W A;  5AQX A;  3GDQ A;  2I61 A;  3BK3 C;  1SN4 A;  3HSC A;  2K35 A;  1DKG D;  5BN8 A;  1VNB A;  1ICA A;  1B7D A;  2KBH A;  3L4I A;  1WMT A;  2A7T A;  1I2V A;  3CQX A;  2E0H A;  2NY8 X;  5AQR A;  2VY6 A;  1JKZ A;  1CHZ A;  1NGC A;  4AAZ A; 
#chains in the Genus database with same CATH homology
 1C55 A;  1GPT A;  1ZYW A;  1L4V A;  1JXC A;  2B3C A;  2KSK A;  1SN1 A;  1WWN A;  1AYJ A;  2MZ0 A;  2N66 A;  1BRZ A;  2ASC A;  1NRA A;  2LJM A;  1I6G A;  1ZU3 A;  1T7B A;  1BMR A;  2ATB A;  1AHO A;  2KPY A;  1LQQ A;  1C56 A;  1P0A A;  2KJA A;  5KK4 A;  1T7A A;  1BK8 A;  1P00 A;  1NRB A;  2YEO A;  1JZA A;  2BRZ A;  2E3G A;  1MR4 A;  1N4N A;  2M8B B;  2E3F A;  1PTX A;  2N69 A;  2SN3 A;  1T7E A;  4HE7 A;  1I6F A;  4AEI A;  1SEG A;  2YC1 C;  2LR3 A;  2LI7 A;  1T0Z A;  1PE4 A;  4HHF A;  1OZZ A;  5CY0 A;  2KGQ A;  1VNA A;  1TI5 A;  2KBJ A;  1SNB A;  1T1T A;  1ZFU A;  1ZVG A;  2B68 A;  2LKB A;  2LY5 A;  2KYQ A;  1WT7 A;  1BCG A;  1NE5 A;  2N2Q A;  3PSM A;  1OMY A;  3E7R L;  4V1D C;  1PX9 A;  1I2U A;  1KV0 A;  1GPS A;  1ZYV A;  4CQK A;  1LQH A;  1NH5 A;  2KBK A;  1B3C A;  1LQI A;  2LJ7 A;  3E7U X;  2LY6 A;  2YBR C;  1FH3 A;  1DQ7 A;  4AB0 A;  2GL1 A;  1NPI A;  1MYN A;  4UJ0 A;  1JZB A;  1DJT A;  2LT8 A;  2N2R A;  2NY9 X;  1CN2 A;  1ZUT A;  1ZVE A;  4KYP A;  2I61 A;  1SN4 A;  1VNB A;  1ICA A;  1B7D A;  2KBH A;  1I2V A;  1WMT A;  2A7T A;  2E0H A;  2NY8 X;  1JKZ A;  1CHZ A;  4AAZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...