1JKZA

Nmr solution structure of pisum sativum defensin 1 (psd1)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEFENSE-RELATED PEPTIDE 1
publication title Solution structure of Pisum sativum defensin 1 by high resolution NMR: plant defensins, identical backbone with different mechanisms of action.
pubmed doi rcsb
molecule tags Antifungal protein
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1jkzA00
2KBJA 1ZVGA 2KSKA 2KGQA 1NRAA 4HE7A 2GL1A 3E7RL 1BK8A 1SN1A 2BRZA 2B3CA 1PX9A 1NPIA 1ZUTA 1PTXA 2LY5A 1C56A 1NE5A 4UJ0A 1T1TA 2KJAA 5CY0A 2KYQA 2YBRC 1ZU3A 1N4NA 1T7EA 2ASCA 1GPTA 1GPSA 2N69A 2LT8A 4AAZA 1ICAA 1I2UA 2LI7A 1T0ZA 2YEOA 1I6GA 1VNAA 1FH3A 1L4VA 1LQIA 2I61A 2MZ0A 1LQQA 2N66A 2B68A 1T7BA 2NY8X 1OMYA 2N2QA 1JXCA 1SNBA 1JZAA 1NRBA 2LY6A 1LQHA 1ZVEA 1AHOA 1ZYVA 1BMRA 1P0AA 1WT7A 1KV0A 1B7DA 1T7AA 1MR4A 1AYJA 2KPYA 1JKZA 1BCGA 1DQ7A 4CQKA 2ATBA 1CN2A 2LJ7A 1NH5A 4V1DC 1ZYWA 4AB0A 2LJMA 1ZFUA 1JZBA 2N2RA 5KK4A 1C55A 3PSMA 1CHZA 1DJTA 2E0HA 2KBKA 1MYNA 1SN4A 1VNBA 2LKBA 2NY9X 2KBHA 4HHFA 1I2VA 2A7TA 3E7UX 1P00A 1SEGA 1BRZA 1TI5A 1B3CA 2E3GA 1WMTA 1OZZA 1WWNA 4KYPA 2E3FA 2LR3A 1PE4A 2M8BB 2SN3A 2YC1C 1I6FA 4AEIA
chains in the Genus database with same CATH superfamily
2KBJA 3C7NA 3IUCA 2D56A 2YIOA 5AQHA 1ZVGA 2KSKA 2KGQA 1HJOA 4FSVA 4UAEF 1NRAA 2MBKA 3GL1A 4HE7A 1NGAA 2GL1A 3E7RL 1I2VA 1BK8A 1NGGA 4H5WA 1SN1A 2BRZA 3D2FB 2B3CA 2E8AA 3D2FA 2JDQD 1PX9A 3A8YA 3KVGA 1NPIA 1BA1A 1ZUTA 1C55A 5AQXA 1PTXA 2QXLA 2LY5A 2E2FA 1C56A 3CQXA 5AQFA 5FPEA 3JXUA 1NGHA 1NE5A 4H5VA 1BA0A 3KOWA 4UJ0A 1NGFA 1POIA 4KBOA 3KC6A 5AR0A 1T1TA 2KJAA 5AQLA 2KYQA 5CY0A 2YBRC 1ZU3A 1N4NA 1T7EA 3L56A 3ATUA 2E88A 2ASCA 1GPTA 4UADE 3M3ZA 5EX5A 1GPSA 3FZHA 5F1XA 4H5TA 1KAZA 2N69A 1HPMA 2LT8A 2VY6A 5BN8A 5AQVA 5EY4A 5FPDA 3KOYA 3KOZA 4AAZA 5BPMA 1I2UA 1ICAA 1K8BA 2YILA 5BPNA 1NGDA 1T0ZA 2LI7A 2YEOA 1I6GA 1VNAA 5AQJA 1FH3A 1LQIA 2I61A 2MZ0A 1L4VA 1LQQA 2GMOA 5AQWA 1NGCA 3KP0A 3GKUA 2BUPA 3BK3C 2N66A 4H5RA 2B68A 1KAXA 1T7BA 2NY8X 1OMYA 2N2QA 3AY9A 1QQMA 3KP1A 1JXCA 1SNBA 1ATSA 3FZFA 2QWMA 1JZAA 5EVZA 1HX1A 2QWNA 5AQUA 1NRBA 2LY6A 3QFUA 5BPLA 3QMLA 1LQHA 1NGEA 1ZVEA 1AHOA 5AQZA 1ZYVA 1XRSB 1BMRA 3LDOA 1P0AA 1WT7A 2LN8A 1KAYA 2KHOA 1KV0A 3KOXA 1B7DA 1T7AA 2QWOA 1YUWA 1MR4A 1AYJA 2KPYA 1JKZA 1BCGA 1DQ7A 4CQKA 2ATBA 1CN2A 5FPMA 2LJ7A 1NH5A 1UGLA 5AQKA 4V1DC 1ZYWA 2QWPA 4AB0A 2LJMA 1ZFUA 1JZBA 2N2RA 2QW9A 5AQQA 5EXWA 2QWRA 5KK4A 3LDQA 3QFPA 3PSMA 1CHZA 1DJTA 2E0HA 3HSCA 3LDNA 3LDLA 2MN5A 4H5NA 3FE1A 5F2RA 2KBKA 1MYNA 1SN4A 3C7NB 1VNBA 2LKBA 2NY9X 3KHWA 5AQYA 1S3XA 3L6QA 5AQRA 5AQOA 5FPNA 2G2KA 3ATVA 2QWQA 3R2VA 4HWIA 5AQIA 5AQMA 2KBHA 1NGJA 4HHFA 2A7TA 4UAFE 3SF4D 3L4IA 5F0XA 1ATRA 1P00A 3D2EB 3D2EA 1QQNA 2YIPA 3CW4A 3E7UX 2K35A 3QI7A 5AQTA 4GNIA 5AQSA 1NGIA 1SEGA 1BRZA 1DKGD 1TI5A 3I33A 4IO8A 5BN9A 1B3CA 2E3GA 2V7ZA 1WMTA 1OZZA 1WWNA 3GDQA 5AQNA 1QQOA 2YC1C 5AQPA 3FZKA 1BUPA 4KYPA 5AQGA 3FZLA 2E3FA 3LDPA 2LR3A 3FZMA 1PE4A 4FL9A 2M8BB 1NGBA 2SN3A 2QWLA 1I6FA 4AEIA
chains in the Genus database with same CATH topology
2KBJA 1ZVGA 2KSKA 2KGQA 1NRAA 4HE7A 2GL1A 3E7RL 1BK8A 1SN1A 2BRZA 2B3CA 1PX9A 1NPIA 1ZUTA 1PTXA 2LY5A 1C56A 1NE5A 4UJ0A 1T1TA 2KJAA 5CY0A 2KYQA 2YBRC 1ZU3A 1N4NA 1T7EA 2ASCA 1GPTA 1GPSA 2N69A 2LT8A 4AAZA 1ICAA 1I2UA 2LI7A 1T0ZA 2YEOA 1I6GA 1VNAA 1FH3A 1L4VA 1LQIA 2I61A 2MZ0A 1LQQA 2N66A 2B68A 1T7BA 2NY8X 1OMYA 2N2QA 1JXCA 1SNBA 1JZAA 1NRBA 2LY6A 1LQHA 1ZVEA 1AHOA 1ZYVA 1BMRA 1P0AA 1WT7A 1KV0A 1B7DA 1T7AA 1MR4A 1AYJA 2KPYA 1JKZA 1BCGA 1DQ7A 4CQKA 2ATBA 1CN2A 2LJ7A 1NH5A 4V1DC 1ZYWA 4AB0A 2LJMA 1ZFUA 1JZBA 2N2RA 5KK4A 1C55A 3PSMA 1CHZA 1DJTA 2E0HA 2KBKA 1MYNA 1SN4A 1VNBA 2LKBA 2NY9X 2KBHA 4HHFA 1I2VA 2A7TA 3E7UX 1P00A 1SEGA 1BRZA 1TI5A 1B3CA 2E3GA 1WMTA 1OZZA 1WWNA 4KYPA 2E3FA 2LR3A 1PE4A 2M8BB 2SN3A 2YC1C 1I6FA 4AEIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KBJ A;  1ZVG A;  2KSK A;  2KGQ A;  1NRA A;  4HE7 A;  2GL1 A;  3E7R L;  1BK8 A;  1SN1 A;  2BRZ A;  2B3C A;  1PX9 A;  1NPI A;  1ZUT A;  1PTX A;  2LY5 A;  1C56 A;  1NE5 A;  4UJ0 A;  1T1T A;  2KJA A;  5CY0 A;  2KYQ A;  2YBR C;  1ZU3 A;  1N4N A;  1T7E A;  2ASC A;  1GPT A;  1GPS A;  2N69 A;  2LT8 A;  4AAZ A;  1ICA A;  1I2U A;  2LI7 A;  1T0Z A;  2YEO A;  1I6G A;  1VNA A;  1FH3 A;  1L4V A;  1LQI A;  2I61 A;  2MZ0 A;  1LQQ A;  2N66 A;  2B68 A;  1T7B A;  2NY8 X;  1OMY A;  2N2Q A;  1JXC A;  1SNB A;  1JZA A;  1NRB A;  2LY6 A;  1LQH A;  1ZVE A;  1AHO A;  1ZYV A;  1BMR A;  1P0A A;  1WT7 A;  1KV0 A;  1B7D A;  1T7A A;  1MR4 A;  1AYJ A;  2KPY A;  1JKZ A;  1BCG A;  1DQ7 A;  4CQK A;  2ATB A;  1CN2 A;  2LJ7 A;  1NH5 A;  4V1D C;  1ZYW A;  4AB0 A;  2LJM A;  1ZFU A;  1JZB A;  2N2R A;  5KK4 A;  1C55 A;  3PSM A;  1CHZ A;  1DJT A;  2E0H A;  2KBK A;  1MYN A;  1SN4 A;  1VNB A;  2LKB A;  2NY9 X;  2KBH A;  4HHF A;  1I2V A;  2A7T A;  3E7U X;  1P00 A;  1SEG A;  1BRZ A;  1TI5 A;  1B3C A;  2E3G A;  1WMT A;  1OZZ A;  1WWN A;  4KYP A;  2E3F A;  2LR3 A;  1PE4 A;  2M8B B;  2SN3 A;  2YC1 C;  1I6F A;  4AEI A; 
#chains in the Genus database with same CATH topology
 2KBJ A;  3C7N A;  3IUC A;  2D56 A;  2YIO A;  5AQH A;  1ZVG A;  2KSK A;  2KGQ A;  1HJO A;  4FSV A;  4UAE F;  1NRA A;  2MBK A;  3GL1 A;  4HE7 A;  1NGA A;  2GL1 A;  3E7R L;  1I2V A;  1BK8 A;  1NGG A;  4H5W A;  1SN1 A;  2BRZ A;  3D2F B;  2B3C A;  2E8A A;  3D2F A;  2JDQ D;  1PX9 A;  3A8Y A;  3KVG A;  1NPI A;  1BA1 A;  1ZUT A;  1C55 A;  5AQX A;  1PTX A;  2QXL A;  2LY5 A;  2E2F A;  1C56 A;  3CQX A;  5AQF A;  5FPE A;  3JXU A;  1NGH A;  1NE5 A;  4H5V A;  1BA0 A;  3KOW A;  4UJ0 A;  1NGF A;  1POI A;  4KBO A;  3KC6 A;  5AR0 A;  1T1T A;  2KJA A;  5AQL A;  2KYQ A;  5CY0 A;  2YBR C;  1ZU3 A;  1N4N A;  1T7E A;  3L56 A;  3ATU A;  2E88 A;  2ASC A;  1GPT A;  4UAD E;  3M3Z A;  5EX5 A;  1GPS A;  3FZH A;  5F1X A;  4H5T A;  1KAZ A;  2N69 A;  1HPM A;  2LT8 A;  2VY6 A;  5BN8 A;  5AQV A;  5EY4 A;  5FPD A;  3KOY A;  3KOZ A;  4AAZ A;  5BPM A;  1I2U A;  1ICA A;  1K8B A;  2YIL A;  5BPN A;  1NGD A;  1T0Z A;  2LI7 A;  2YEO A;  1I6G A;  1VNA A;  5AQJ A;  1FH3 A;  1LQI A;  2I61 A;  2MZ0 A;  1L4V A;  1LQQ A;  2GMO A;  5AQW A;  1NGC A;  3KP0 A;  3GKU A;  2BUP A;  3BK3 C;  2N66 A;  4H5R A;  2B68 A;  1KAX A;  1T7B A;  2NY8 X;  1OMY A;  2N2Q A;  3AY9 A;  1QQM A;  3KP1 A;  1JXC A;  1SNB A;  1ATS A;  3FZF A;  2QWM A;  1JZA A;  5EVZ A;  1HX1 A;  2QWN A;  5AQU A;  1NRB A;  2LY6 A;  3QFU A;  5BPL A;  3QML A;  1LQH A;  1NGE A;  1ZVE A;  1AHO A;  5AQZ A;  1ZYV A;  1XRS B;  1BMR A;  3LDO A;  1P0A A;  1WT7 A;  2LN8 A;  1KAY A;  2KHO A;  1KV0 A;  3KOX A;  1B7D A;  1T7A A;  2QWO A;  1YUW A;  1MR4 A;  1AYJ A;  2KPY A;  1JKZ A;  1BCG A;  1DQ7 A;  4CQK A;  2ATB A;  1CN2 A;  5FPM A;  2LJ7 A;  1NH5 A;  1UGL A;  5AQK A;  4V1D C;  1ZYW A;  2QWP A;  4AB0 A;  2LJM A;  1ZFU A;  1JZB A;  2N2R A;  2QW9 A;  5AQQ A;  5EXW A;  2QWR A;  5KK4 A;  3LDQ A;  3QFP A;  3PSM A;  1CHZ A;  1DJT A;  2E0H A;  3HSC A;  3LDN A;  3LDL A;  2MN5 A;  4H5N A;  3FE1 A;  5F2R A;  2KBK A;  1MYN A;  1SN4 A;  3C7N B;  1VNB A;  2LKB A;  2NY9 X;  3KHW A;  5AQY A;  1S3X A;  3L6Q A;  5AQR A;  5AQO A;  5FPN A;  2G2K A;  3ATV A;  2QWQ A;  3R2V A;  4HWI A;  5AQI A;  5AQM A;  2KBH A;  1NGJ A;  4HHF A;  2A7T A;  4UAF E;  3SF4 D;  3L4I A;  5F0X A;  1ATR A;  1P00 A;  3D2E B;  3D2E A;  1QQN A;  2YIP A;  3CW4 A;  3E7U X;  2K35 A;  3QI7 A;  5AQT A;  4GNI A;  5AQS A;  1NGI A;  1SEG A;  1BRZ A;  1DKG D;  1TI5 A;  3I33 A;  4IO8 A;  5BN9 A;  1B3C A;  2E3G A;  2V7Z A;  1WMT A;  1OZZ A;  1WWN A;  3GDQ A;  5AQN A;  1QQO A;  2YC1 C;  5AQP A;  3FZK A;  1BUP A;  4KYP A;  5AQG A;  3FZL A;  2E3F A;  3LDP A;  2LR3 A;  3FZM A;  1PE4 A;  4FL9 A;  2M8B B;  1NGB A;  2SN3 A;  2QWL A;  1I6F A;  4AEI A; 
#chains in the Genus database with same CATH homology
 2KBJ A;  1ZVG A;  2KSK A;  2KGQ A;  1NRA A;  4HE7 A;  2GL1 A;  3E7R L;  1BK8 A;  1SN1 A;  2BRZ A;  2B3C A;  1PX9 A;  1NPI A;  1ZUT A;  1PTX A;  2LY5 A;  1C56 A;  1NE5 A;  4UJ0 A;  1T1T A;  2KJA A;  5CY0 A;  2KYQ A;  2YBR C;  1ZU3 A;  1N4N A;  1T7E A;  2ASC A;  1GPT A;  1GPS A;  2N69 A;  2LT8 A;  4AAZ A;  1ICA A;  1I2U A;  2LI7 A;  1T0Z A;  2YEO A;  1I6G A;  1VNA A;  1FH3 A;  1L4V A;  1LQI A;  2I61 A;  2MZ0 A;  1LQQ A;  2N66 A;  2B68 A;  1T7B A;  2NY8 X;  1OMY A;  2N2Q A;  1JXC A;  1SNB A;  1JZA A;  1NRB A;  2LY6 A;  1LQH A;  1ZVE A;  1AHO A;  1ZYV A;  1BMR A;  1P0A A;  1WT7 A;  1KV0 A;  1B7D A;  1T7A A;  1MR4 A;  1AYJ A;  2KPY A;  1JKZ A;  1BCG A;  1DQ7 A;  4CQK A;  2ATB A;  1CN2 A;  2LJ7 A;  1NH5 A;  4V1D C;  1ZYW A;  4AB0 A;  2LJM A;  1ZFU A;  1JZB A;  2N2R A;  5KK4 A;  1C55 A;  3PSM A;  1CHZ A;  1DJT A;  2E0H A;  2KBK A;  1MYN A;  1SN4 A;  1VNB A;  2LKB A;  2NY9 X;  2KBH A;  4HHF A;  1I2V A;  2A7T A;  3E7U X;  1P00 A;  1SEG A;  1BRZ A;  1TI5 A;  1B3C A;  2E3G A;  1WMT A;  1OZZ A;  1WWN A;  4KYP A;  2E3F A;  2LR3 A;  1PE4 A;  2M8B B;  2SN3 A;  2YC1 C;  1I6F A;  4AEI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...