1JKZA

Nmr solution structure of pisum sativum defensin 1 (psd1)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
46
structure length
46
Chain Sequence
b'KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEFENSE-RELATED PEPTIDE 1
publication title Solution structure of Pisum sativum defensin 1 by high resolution NMR: plant defensins, identical backbone with different mechanisms of action.
pubmed doi rcsb
molecule tags Antifungal protein
total genus 7
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2001-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1jkzA00
5KK4A 1TI5A 1GPTA 1ZU3A 1CHZA 2YBRC 1L4VA 2GL1A 4CQKA 1B7DA 2B68A 1BMRA 1MYNA 2N69A 1CN2A 1PTXA 1I6FA 2B3CA 1BCGA 4AAZA 1SN1A 1T1TA 2LY5A 1P00A 2KBHA 1C55A 4AEIA 1ZYVA 3PSMA 3E7UX 1T7AA 1LQQA 1KV0A 2LJ7A 1AYJA 2NY9X 2ASCA 1NPIA 4V1DC 1WMTA 2ATBA 2E3FA 2E0HA 1VNAA 2N2RA 1NE5A 1NRBA 2YC1C 1MR4A 1NRAA 1VNBA 1LQIA 1ZUTA 1JZBA 2LI7A 2KBJA 2KYQA 1BK8A 1ZYWA 2A7TA 1WT7A 1OZZA 1P0AA 1JXCA 2NY8X 1ICAA 1DQ7A 1T7EA 3E7RL 2BRZA 1LQHA 2E3GA 2I61A 4KYPA 1AHOA 1I6GA 2MZ0A 1T0ZA 2KGQA 1WWNA 1T7BA 1BRZA 2LR3A 2N66A 1ZFUA 5CY0A 1DJTA 1PX9A 2LJMA 1I2UA 1JKZA 2KJAA 1I2VA 1OMYA 2YEOA 1FH3A 1B3CA 2KBKA 4UJ0A 2M8BB 1SEGA 4AB0A 2N2QA 1JZAA 1NH5A 2KPYA 4HHFA 1C56A 1SN4A 1N4NA 1ZVGA 2LY6A 4HE7A 2LKBA 1SNBA 1PE4A 2KSKA 2LT8A 1ZVEA 1GPSA 2SN3A
chains in the Genus database with same CATH superfamily
1KAYA 3FE1A 3FZLA 2MN5A 1DKGD 1NGAA 1TI5A 5KK4A 1GPSA 2E8AA 1GPTA 1POIA 5AQGA 4GNIA 1NGHA 2QWQA 3L6QA 3KHWA 1ZU3A 3QI7A 1CHZA 2YBRC 3GL1A 1L4VA 2GL1A 4CQKA 2QWLA 5AR0A 1B7DA 5FPMA 2B68A 1HX1A 1NGEA 1MYNA 2N69A 2GMOA 5EXWA 1BMRA 1CN2A 1PTXA 4H5RA 1I6FA 1NGJA 4UAEF 1UGLA 2B3CA 1BCGA 4UADE 1SN1A 3CW4A 4AAZA 1T1TA 5AQSA 2QWOA 1KAXA 1P00A 2LY5A 3LDNA 2KBHA 4KBOA 4AEIA 1C55A 3GDQA 5AQFA 3D2EA 1ZYVA 3PSMA 3E7UX 1T7AA 1LQQA 1KV0A 5AQOA 1KAZA 2LJ7A 2KHOA 3FZKA 4IO8A 1AYJA 2NY9X 2ASCA 2YIOA 1NPIA 4V1DC 1WMTA 2ATBA 2E3FA 1BA0A 3GKUA 1BUPA 3ATVA 1BA1A 3KOWA 2YIPA 5BPNA 1NGDA 2E0HA 2V7ZA 4H5VA 3L4IA 1VNAA 2MBKA 2JDQD 5AQHA 3BK3C 2N2RA 3LDOA 1NE5A 1NRBA 2D56A 2QWRA 2YC1C 1MR4A 5AQYA 3I33A 1NRAA 3D2FA 2BUPA 1VNBA 2E2FA 1LQIA 3FZMA 3KVGA 1ZUTA 1JZBA 2LI7A 2QWNA 1HPMA 3M3ZA 2KBJA 2KYQA 3FZHA 1BK8A 1ZYWA 5AQIA 1XRSB 2A7TA 1QQMA 1OZZA 1WT7A 4H5TA 1P0AA 3C7NB 5F2RA 5BPLA 1JXCA 2NY8X 2QWMA 1ICAA 1DQ7A 1T7EA 2YILA 3E7RL 1ATSA 1S3XA 5AQJA 5AQTA 2BRZA 2LN8A 1LQHA 2E3GA 3A8YA 2I61A 3QMLA 5FPEA 4KYPA 5AQXA 1AHOA 3KP1A 3R2VA 1NGCA 4FSVA 2QXLA 3KOZA 5AQLA 1I6GA 2MZ0A 1T0ZA 2KGQA 1QQNA 5AQKA 5F0XA 5AQWA 1WWNA 1T7BA 3LDLA 1BRZA 1YUWA 3QFPA 3QFUA 3KOXA 4H5NA 2LR3A 2N66A 3HSCA 3LDPA 5BPMA 1ZFUA 5BN9A 5CY0A 1DJTA 1PX9A 2LJMA 1I2UA 1JKZA 2E88A 3L56A 5AQQA 2KJAA 5EY4A 1I2VA 1OMYA 1NGGA 2YEOA 1FH3A 1B3CA 3KC6A 2KBKA 3FZFA 5AQNA 1NGBA 4H5WA 4UJ0A 5F1XA 3CQXA 5EVZA 2M8BB 3AY9A 1SEGA 3JXUA 4AB0A 2N2QA 3D2EB 3KOYA 1JZAA 2G2KA 3ATUA 1NH5A 2QWPA 2VY6A 5FPNA 3LDQA 4UAFE 1HJOA 2KPYA 4HWIA 5AQRA 1NGIA 1ATRA 4HHFA 1C56A 2K35A 2QW9A 1SN4A 1N4NA 1NGFA 5AQPA 5BN8A 1QQOA 3KP0A 1ZVGA 2LY6A 3C7NA 4HE7A 1K8BA 2LKBA 5FPDA 5AQMA 1SNBA 1PE4A 3SF4D 2KSKA 2LT8A 3D2FB 3IUCA 5AQUA 1ZVEA 5AQVA 2SN3A 5EX5A 4FL9A 5AQZA
chains in the Genus database with same CATH topology
5KK4A 1TI5A 1GPTA 1ZU3A 1CHZA 2YBRC 1L4VA 2GL1A 4CQKA 1B7DA 2B68A 1BMRA 1MYNA 2N69A 1CN2A 1PTXA 1I6FA 2B3CA 1BCGA 4AAZA 1SN1A 1T1TA 2LY5A 1P00A 2KBHA 1C55A 4AEIA 1ZYVA 3PSMA 3E7UX 1T7AA 1LQQA 1KV0A 2LJ7A 1AYJA 2NY9X 2ASCA 1NPIA 4V1DC 1WMTA 2ATBA 2E3FA 2E0HA 1VNAA 2N2RA 1NE5A 1NRBA 2YC1C 1MR4A 1NRAA 1VNBA 1LQIA 1ZUTA 1JZBA 2LI7A 2KBJA 2KYQA 1BK8A 1ZYWA 2A7TA 1WT7A 1OZZA 1P0AA 1JXCA 2NY8X 1ICAA 1DQ7A 1T7EA 3E7RL 2BRZA 1LQHA 2E3GA 2I61A 4KYPA 1AHOA 1I6GA 2MZ0A 1T0ZA 2KGQA 1WWNA 1T7BA 1BRZA 2LR3A 2N66A 1ZFUA 5CY0A 1DJTA 1PX9A 2LJMA 1I2UA 1JKZA 2KJAA 1I2VA 1OMYA 2YEOA 1FH3A 1B3CA 2KBKA 4UJ0A 2M8BB 1SEGA 4AB0A 2N2QA 1JZAA 1NH5A 2KPYA 4HHFA 1C56A 1SN4A 1N4NA 1ZVGA 2LY6A 4HE7A 2LKBA 1SNBA 1PE4A 2KSKA 2LT8A 1ZVEA 1GPSA 2SN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KK4 A;  1TI5 A;  1GPT A;  1ZU3 A;  1CHZ A;  2YBR C;  1L4V A;  2GL1 A;  4CQK A;  1B7D A;  2B68 A;  1BMR A;  1MYN A;  2N69 A;  1CN2 A;  1PTX A;  1I6F A;  2B3C A;  1BCG A;  4AAZ A;  1SN1 A;  1T1T A;  2LY5 A;  1P00 A;  2KBH A;  1C55 A;  4AEI A;  1ZYV A;  3PSM A;  3E7U X;  1T7A A;  1LQQ A;  1KV0 A;  2LJ7 A;  1AYJ A;  2NY9 X;  2ASC A;  1NPI A;  4V1D C;  1WMT A;  2ATB A;  2E3F A;  2E0H A;  1VNA A;  2N2R A;  1NE5 A;  1NRB A;  2YC1 C;  1MR4 A;  1NRA A;  1VNB A;  1LQI A;  1ZUT A;  1JZB A;  2LI7 A;  2KBJ A;  2KYQ A;  1BK8 A;  1ZYW A;  2A7T A;  1WT7 A;  1OZZ A;  1P0A A;  1JXC A;  2NY8 X;  1ICA A;  1DQ7 A;  1T7E A;  3E7R L;  2BRZ A;  1LQH A;  2E3G A;  2I61 A;  4KYP A;  1AHO A;  1I6G A;  2MZ0 A;  1T0Z A;  2KGQ A;  1WWN A;  1T7B A;  1BRZ A;  2LR3 A;  2N66 A;  1ZFU A;  5CY0 A;  1DJT A;  1PX9 A;  2LJM A;  1I2U A;  1JKZ A;  2KJA A;  1I2V A;  1OMY A;  2YEO A;  1FH3 A;  1B3C A;  2KBK A;  4UJ0 A;  2M8B B;  1SEG A;  4AB0 A;  2N2Q A;  1JZA A;  1NH5 A;  2KPY A;  4HHF A;  1C56 A;  1SN4 A;  1N4N A;  1ZVG A;  2LY6 A;  4HE7 A;  2LKB A;  1SNB A;  1PE4 A;  2KSK A;  2LT8 A;  1ZVE A;  1GPS A;  2SN3 A; 
#chains in the Genus database with same CATH topology
 1KAY A;  3FE1 A;  3FZL A;  2MN5 A;  1DKG D;  1NGA A;  1TI5 A;  5KK4 A;  1GPS A;  2E8A A;  1GPT A;  1POI A;  5AQG A;  4GNI A;  1NGH A;  2QWQ A;  3L6Q A;  3KHW A;  1ZU3 A;  3QI7 A;  1CHZ A;  2YBR C;  3GL1 A;  1L4V A;  2GL1 A;  4CQK A;  2QWL A;  5AR0 A;  1B7D A;  5FPM A;  2B68 A;  1HX1 A;  1NGE A;  1MYN A;  2N69 A;  2GMO A;  5EXW A;  1BMR A;  1CN2 A;  1PTX A;  4H5R A;  1I6F A;  1NGJ A;  4UAE F;  1UGL A;  2B3C A;  1BCG A;  4UAD E;  1SN1 A;  3CW4 A;  4AAZ A;  1T1T A;  5AQS A;  2QWO A;  1KAX A;  1P00 A;  2LY5 A;  3LDN A;  2KBH A;  4KBO A;  4AEI A;  1C55 A;  3GDQ A;  5AQF A;  3D2E A;  1ZYV A;  3PSM A;  3E7U X;  1T7A A;  1LQQ A;  1KV0 A;  5AQO A;  1KAZ A;  2LJ7 A;  2KHO A;  3FZK A;  4IO8 A;  1AYJ A;  2NY9 X;  2ASC A;  2YIO A;  1NPI A;  4V1D C;  1WMT A;  2ATB A;  2E3F A;  1BA0 A;  3GKU A;  1BUP A;  3ATV A;  1BA1 A;  3KOW A;  2YIP A;  5BPN A;  1NGD A;  2E0H A;  2V7Z A;  4H5V A;  3L4I A;  1VNA A;  2MBK A;  2JDQ D;  5AQH A;  3BK3 C;  2N2R A;  3LDO A;  1NE5 A;  1NRB A;  2D56 A;  2QWR A;  2YC1 C;  1MR4 A;  5AQY A;  3I33 A;  1NRA A;  3D2F A;  2BUP A;  1VNB A;  2E2F A;  1LQI A;  3FZM A;  3KVG A;  1ZUT A;  1JZB A;  2LI7 A;  2QWN A;  1HPM A;  3M3Z A;  2KBJ A;  2KYQ A;  3FZH A;  1BK8 A;  1ZYW A;  5AQI A;  1XRS B;  2A7T A;  1QQM A;  1OZZ A;  1WT7 A;  4H5T A;  1P0A A;  3C7N B;  5F2R A;  5BPL A;  1JXC A;  2NY8 X;  2QWM A;  1ICA A;  1DQ7 A;  1T7E A;  2YIL A;  3E7R L;  1ATS A;  1S3X A;  5AQJ A;  5AQT A;  2BRZ A;  2LN8 A;  1LQH A;  2E3G A;  3A8Y A;  2I61 A;  3QML A;  5FPE A;  4KYP A;  5AQX A;  1AHO A;  3KP1 A;  3R2V A;  1NGC A;  4FSV A;  2QXL A;  3KOZ A;  5AQL A;  1I6G A;  2MZ0 A;  1T0Z A;  2KGQ A;  1QQN A;  5AQK A;  5F0X A;  5AQW A;  1WWN A;  1T7B A;  3LDL A;  1BRZ A;  1YUW A;  3QFP A;  3QFU A;  3KOX A;  4H5N A;  2LR3 A;  2N66 A;  3HSC A;  3LDP A;  5BPM A;  1ZFU A;  5BN9 A;  5CY0 A;  1DJT A;  1PX9 A;  2LJM A;  1I2U A;  1JKZ A;  2E88 A;  3L56 A;  5AQQ A;  2KJA A;  5EY4 A;  1I2V A;  1OMY A;  1NGG A;  2YEO A;  1FH3 A;  1B3C A;  3KC6 A;  2KBK A;  3FZF A;  5AQN A;  1NGB A;  4H5W A;  4UJ0 A;  5F1X A;  3CQX A;  5EVZ A;  2M8B B;  3AY9 A;  1SEG A;  3JXU A;  4AB0 A;  2N2Q A;  3D2E B;  3KOY A;  1JZA A;  2G2K A;  3ATU A;  1NH5 A;  2QWP A;  2VY6 A;  5FPN A;  3LDQ A;  4UAF E;  1HJO A;  2KPY A;  4HWI A;  5AQR A;  1NGI A;  1ATR A;  4HHF A;  1C56 A;  2K35 A;  2QW9 A;  1SN4 A;  1N4N A;  1NGF A;  5AQP A;  5BN8 A;  1QQO A;  3KP0 A;  1ZVG A;  2LY6 A;  3C7N A;  4HE7 A;  1K8B A;  2LKB A;  5FPD A;  5AQM A;  1SNB A;  1PE4 A;  3SF4 D;  2KSK A;  2LT8 A;  3D2F B;  3IUC A;  5AQU A;  1ZVE A;  5AQV A;  2SN3 A;  5EX5 A;  4FL9 A;  5AQZ A; 
#chains in the Genus database with same CATH homology
 5KK4 A;  1TI5 A;  1GPT A;  1ZU3 A;  1CHZ A;  2YBR C;  1L4V A;  2GL1 A;  4CQK A;  1B7D A;  2B68 A;  1BMR A;  1MYN A;  2N69 A;  1CN2 A;  1PTX A;  1I6F A;  2B3C A;  1BCG A;  4AAZ A;  1SN1 A;  1T1T A;  2LY5 A;  1P00 A;  2KBH A;  1C55 A;  4AEI A;  1ZYV A;  3PSM A;  3E7U X;  1T7A A;  1LQQ A;  1KV0 A;  2LJ7 A;  1AYJ A;  2NY9 X;  2ASC A;  1NPI A;  4V1D C;  1WMT A;  2ATB A;  2E3F A;  2E0H A;  1VNA A;  2N2R A;  1NE5 A;  1NRB A;  2YC1 C;  1MR4 A;  1NRA A;  1VNB A;  1LQI A;  1ZUT A;  1JZB A;  2LI7 A;  2KBJ A;  2KYQ A;  1BK8 A;  1ZYW A;  2A7T A;  1WT7 A;  1OZZ A;  1P0A A;  1JXC A;  2NY8 X;  1ICA A;  1DQ7 A;  1T7E A;  3E7R L;  2BRZ A;  1LQH A;  2E3G A;  2I61 A;  4KYP A;  1AHO A;  1I6G A;  2MZ0 A;  1T0Z A;  2KGQ A;  1WWN A;  1T7B A;  1BRZ A;  2LR3 A;  2N66 A;  1ZFU A;  5CY0 A;  1DJT A;  1PX9 A;  2LJM A;  1I2U A;  1JKZ A;  2KJA A;  1I2V A;  1OMY A;  2YEO A;  1FH3 A;  1B3C A;  2KBK A;  4UJ0 A;  2M8B B;  1SEG A;  4AB0 A;  2N2Q A;  1JZA A;  1NH5 A;  2KPY A;  4HHF A;  1C56 A;  1SN4 A;  1N4N A;  1ZVG A;  2LY6 A;  4HE7 A;  2LKB A;  1SNB A;  1PE4 A;  2KSK A;  2LT8 A;  1ZVE A;  1GPS A;  2SN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...