2E0HA

Solution structure of bmkalphait01, an alpha-insect toxin from the venom of the chinese scorpion buthus martensi karsch
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
64
structure length
64
Chain Sequence
VRDAYIAQNYNCVYHCARDAYCNELCTKNGAKSGSCPYLGEHKFACYCKDLPDNVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-neurotoxin TX12
publication title Solution Structure of BmKalphaIT01, an alpha-Insect Toxin from the Venom of the Chinese Scorpion Buthus martensii Karsch
pubmed doi rcsb
molecule tags Toxin
total genus 19
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2006-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2e0hA00
1ZVEA 4AB0A 1MYNA 2KBKA 2LY6A 1NRBA 1NE5A 1WWNA 2N66A 2LJMA 1I2UA 1LQIA 1BK8A 2LT8A 1T7BA 2YEOA 2N2QA 1PX9A 2LKBA 1VNBA 2KSKA 1ZYWA 2NY8X 1ZFUA 1AYJA 1ZVGA 5CY0A 2N2RA 2B3CA 2I61A 1P0AA 1T7AA 2KYQA 2N69A 1JXCA 1N4NA 2SN3A 2B68A 1LQQA 1ZU3A 1T1TA 1I6GA 1KV0A 1B3CA 2YBRC 1DJTA 1CHZA 2ATBA 4CQKA 1NH5A 1P00A 1I6FA 2BRZA 1WMTA 1JKZA 1FH3A 1DQ7A 5KK4A 2E3GA 4V1DC 1C56A 1TI5A 4HE7A 1SNBA 1OZZA 4AEIA 2A7TA 1SEGA 1JZBA 2LI7A 1MR4A 2M8BB 2LJ7A 2LY5A 4HHFA 2KBJA 4UJ0A 3PSMA 1NRAA 1CN2A 1BCGA 1JZAA 1B7DA 2NY9X 1C55A 1GPSA 1I2VA 1GPTA 2KPYA 3E7UX 2GL1A 1ICAA 2MZ0A 1ZYVA 1T0ZA 1WT7A 1PE4A 3E7RL 1SN1A 2KBHA 4AAZA 1L4VA 1BMRA 2ASCA 1BRZA 1LQHA 1SN4A 1ZUTA 1OMYA 2KJAA 1AHOA 2KGQA 1T7EA 1VNAA 2E3FA 2YC1C 4KYPA 1NPIA 2LR3A 1PTXA 2E0HA
chains in the Genus database with same CATH superfamily
1ZVEA 3A8YA 1UGLA 5AQTA 1NGBA 4AB0A 4H5RA 1MYNA 2KBKA 2LY6A 5AQYA 5FPNA 3D2EA 2QWLA 3BK3C 3C7NA 3FZLA 5AQFA 3KOWA 2QXLA 3I33A 2YIOA 3KOYA 1NRBA 3KHWA 1NE5A 1WWNA 2N66A 5EY4A 3KOXA 2LJMA 3KC6A 3HSCA 3LDNA 3LDPA 1LQIA 3CQXA 1KAZA 1BK8A 1I2UA 2LT8A 4IO8A 1T7BA 2YEOA 2N2QA 1PX9A 3FZMA 2LKBA 3FE1A 4H5WA 1VNBA 2KSKA 3KOZA 2K35A 4H5TA 1ZYWA 2NY8X 5F1XA 1ZFUA 5F0XA 1AYJA 5AQHA 1BA1A 1ZVGA 5CY0A 1NGFA 5AQNA 2QWMA 4H5VA 2N2RA 2B3CA 1YUWA 2I61A 4UAFE 4UADE 1P0AA 4GNIA 1T7AA 2VY6A 2MBKA 3R2VA 2KYQA 3QFUA 2D56A 1KAXA 2QW9A 2YIPA 3L6QA 1I2VA 1NGJA 1JXCA 1NGEA 2N69A 3IUCA 5EXWA 1N4NA 2QWQA 1POIA 1NGCA 2SN3A 5EVZA 2B68A 5AQUA 1LQQA 1ZU3A 3KP1A 1T1TA 1I6GA 1KV0A 1B3CA 2YBRC 1DJTA 1CHZA 5AQVA 2ATBA 5AQSA 4CQKA 1NH5A 1P00A 2YILA 1I6FA 2BRZA 1ATRA 5BPNA 2G2KA 1WMTA 1JKZA 3SF4D 1FH3A 1DQ7A 2E8AA 3FZHA 2E3GA 5FPEA 1QQOA 5KK4A 3KP0A 5BN8A 3D2FB 4V1DC 1QQNA 1C56A 1TI5A 4HE7A 1SNBA 5AR0A 5BPLA 1OZZA 2MN5A 3LDOA 2A7TA 4H5NA 4AEIA 2BUPA 2KHOA 5AQJA 1SEGA 1NGHA 3LDLA 3D2EB 3GDQA 5AQGA 1JZBA 1HJOA 2LI7A 2V7ZA 4UAEF 5FPDA 1K8BA 2QWNA 5AQWA 5F2RA 1MR4A 2JDQD 1BUPA 5FPMA 2E2FA 4FL9A 2M8BB 4FSVA 2LJ7A 5BN9A 2LY5A 5AQXA 1NGGA 4HHFA 2KBJA 4UJ0A 3GKUA 3JXUA 1NRAA 3PSMA 1NGIA 1CN2A 3KVGA 1BCGA 1GPSA 3ATVA 1BA0A 1DKGD 1JZAA 1B7DA 4KBOA 2NY9X 3LDQA 5AQOA 1ATSA 1C55A 1NGAA 2KPYA 3E7UX 1KAYA 2GL1A 5AQMA 1GPTA 5BPMA 1ICAA 1HX1A 2MZ0A 3GL1A 3QI7A 5AQKA 1ZYVA 1T0ZA 1S3XA 1WT7A 5AQPA 1PE4A 2QWOA 3CW4A 3E7RL 3L4IA 1SN1A 3L56A 3ATUA 2KBHA 4AAZA 2E88A 1L4VA 1BMRA 5AQIA 2ASCA 3C7NB 4HWIA 1BRZA 2GMOA 1LQHA 1SN4A 1QQMA 1ZUTA 3QMLA 5AQQA 2QWPA 1XRSB 5AQLA 1OMYA 2KJAA 2LN8A 3FZKA 5AQZA 3QFPA 5AQRA 5EX5A 1AHOA 2KGQA 1T7EA 1VNAA 2E3FA 2YC1C 3AY9A 3M3ZA 4KYPA 1NPIA 2LR3A 3FZFA 1HPMA 1PTXA 2QWRA 3D2FA 1NGDA 2E0HA
chains in the Genus database with same CATH topology
1ZVEA 4AB0A 1MYNA 2KBKA 2LY6A 1NRBA 1NE5A 1WWNA 2N66A 2LJMA 1I2UA 1LQIA 1BK8A 2LT8A 1T7BA 2YEOA 2N2QA 1PX9A 2LKBA 1VNBA 2KSKA 1ZYWA 2NY8X 1ZFUA 1AYJA 1ZVGA 5CY0A 2N2RA 2B3CA 2I61A 1P0AA 1T7AA 2KYQA 2N69A 1JXCA 1N4NA 2SN3A 2B68A 1LQQA 1ZU3A 1T1TA 1I6GA 1KV0A 1B3CA 2YBRC 1DJTA 1CHZA 2ATBA 4CQKA 1NH5A 1P00A 1I6FA 2BRZA 1WMTA 1JKZA 1FH3A 1DQ7A 5KK4A 2E3GA 4V1DC 1C56A 1TI5A 4HE7A 1SNBA 1OZZA 4AEIA 2A7TA 1SEGA 1JZBA 2LI7A 1MR4A 2M8BB 2LJ7A 2LY5A 4HHFA 2KBJA 4UJ0A 3PSMA 1NRAA 1CN2A 1BCGA 1JZAA 1B7DA 2NY9X 1C55A 1GPSA 1I2VA 1GPTA 2KPYA 3E7UX 2GL1A 1ICAA 2MZ0A 1ZYVA 1T0ZA 1WT7A 1PE4A 3E7RL 1SN1A 2KBHA 4AAZA 1L4VA 1BMRA 2ASCA 1BRZA 1LQHA 1SN4A 1ZUTA 1OMYA 2KJAA 1AHOA 2KGQA 1T7EA 1VNAA 2E3FA 2YC1C 4KYPA 1NPIA 2LR3A 1PTXA 2E0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVE A;  4AB0 A;  1MYN A;  2KBK A;  2LY6 A;  1NRB A;  1NE5 A;  1WWN A;  2N66 A;  2LJM A;  1I2U A;  1LQI A;  1BK8 A;  2LT8 A;  1T7B A;  2YEO A;  2N2Q A;  1PX9 A;  2LKB A;  1VNB A;  2KSK A;  1ZYW A;  2NY8 X;  1ZFU A;  1AYJ A;  1ZVG A;  5CY0 A;  2N2R A;  2B3C A;  2I61 A;  1P0A A;  1T7A A;  2KYQ A;  2N69 A;  1JXC A;  1N4N A;  2SN3 A;  2B68 A;  1LQQ A;  1ZU3 A;  1T1T A;  1I6G A;  1KV0 A;  1B3C A;  2YBR C;  1DJT A;  1CHZ A;  2ATB A;  4CQK A;  1NH5 A;  1P00 A;  1I6F A;  2BRZ A;  1WMT A;  1JKZ A;  1FH3 A;  1DQ7 A;  5KK4 A;  2E3G A;  4V1D C;  1C56 A;  1TI5 A;  4HE7 A;  1SNB A;  1OZZ A;  4AEI A;  2A7T A;  1SEG A;  1JZB A;  2LI7 A;  1MR4 A;  2M8B B;  2LJ7 A;  2LY5 A;  4HHF A;  2KBJ A;  4UJ0 A;  3PSM A;  1NRA A;  1CN2 A;  1BCG A;  1JZA A;  1B7D A;  2NY9 X;  1C55 A;  1GPS A;  1I2V A;  1GPT A;  2KPY A;  3E7U X;  2GL1 A;  1ICA A;  2MZ0 A;  1ZYV A;  1T0Z A;  1WT7 A;  1PE4 A;  3E7R L;  1SN1 A;  2KBH A;  4AAZ A;  1L4V A;  1BMR A;  2ASC A;  1BRZ A;  1LQH A;  1SN4 A;  1ZUT A;  1OMY A;  2KJA A;  1AHO A;  2KGQ A;  1T7E A;  1VNA A;  2E3F A;  2YC1 C;  4KYP A;  1NPI A;  2LR3 A;  1PTX A;  2E0H A; 
#chains in the Genus database with same CATH topology
 1ZVE A;  3A8Y A;  1UGL A;  5AQT A;  1NGB A;  4AB0 A;  4H5R A;  1MYN A;  2KBK A;  2LY6 A;  5AQY A;  5FPN A;  3D2E A;  2QWL A;  3BK3 C;  3C7N A;  3FZL A;  5AQF A;  3KOW A;  2QXL A;  3I33 A;  2YIO A;  3KOY A;  1NRB A;  3KHW A;  1NE5 A;  1WWN A;  2N66 A;  5EY4 A;  3KOX A;  2LJM A;  3KC6 A;  3HSC A;  3LDN A;  3LDP A;  1LQI A;  3CQX A;  1KAZ A;  1BK8 A;  1I2U A;  2LT8 A;  4IO8 A;  1T7B A;  2YEO A;  2N2Q A;  1PX9 A;  3FZM A;  2LKB A;  3FE1 A;  4H5W A;  1VNB A;  2KSK A;  3KOZ A;  2K35 A;  4H5T A;  1ZYW A;  2NY8 X;  5F1X A;  1ZFU A;  5F0X A;  1AYJ A;  5AQH A;  1BA1 A;  1ZVG A;  5CY0 A;  1NGF A;  5AQN A;  2QWM A;  4H5V A;  2N2R A;  2B3C A;  1YUW A;  2I61 A;  4UAF E;  4UAD E;  1P0A A;  4GNI A;  1T7A A;  2VY6 A;  2MBK A;  3R2V A;  2KYQ A;  3QFU A;  2D56 A;  1KAX A;  2QW9 A;  2YIP A;  3L6Q A;  1I2V A;  1NGJ A;  1JXC A;  1NGE A;  2N69 A;  3IUC A;  5EXW A;  1N4N A;  2QWQ A;  1POI A;  1NGC A;  2SN3 A;  5EVZ A;  2B68 A;  5AQU A;  1LQQ A;  1ZU3 A;  3KP1 A;  1T1T A;  1I6G A;  1KV0 A;  1B3C A;  2YBR C;  1DJT A;  1CHZ A;  5AQV A;  2ATB A;  5AQS A;  4CQK A;  1NH5 A;  1P00 A;  2YIL A;  1I6F A;  2BRZ A;  1ATR A;  5BPN A;  2G2K A;  1WMT A;  1JKZ A;  3SF4 D;  1FH3 A;  1DQ7 A;  2E8A A;  3FZH A;  2E3G A;  5FPE A;  1QQO A;  5KK4 A;  3KP0 A;  5BN8 A;  3D2F B;  4V1D C;  1QQN A;  1C56 A;  1TI5 A;  4HE7 A;  1SNB A;  5AR0 A;  5BPL A;  1OZZ A;  2MN5 A;  3LDO A;  2A7T A;  4H5N A;  4AEI A;  2BUP A;  2KHO A;  5AQJ A;  1SEG A;  1NGH A;  3LDL A;  3D2E B;  3GDQ A;  5AQG A;  1JZB A;  1HJO A;  2LI7 A;  2V7Z A;  4UAE F;  5FPD A;  1K8B A;  2QWN A;  5AQW A;  5F2R A;  1MR4 A;  2JDQ D;  1BUP A;  5FPM A;  2E2F A;  4FL9 A;  2M8B B;  4FSV A;  2LJ7 A;  5BN9 A;  2LY5 A;  5AQX A;  1NGG A;  4HHF A;  2KBJ A;  4UJ0 A;  3GKU A;  3JXU A;  1NRA A;  3PSM A;  1NGI A;  1CN2 A;  3KVG A;  1BCG A;  1GPS A;  3ATV A;  1BA0 A;  1DKG D;  1JZA A;  1B7D A;  4KBO A;  2NY9 X;  3LDQ A;  5AQO A;  1ATS A;  1C55 A;  1NGA A;  2KPY A;  3E7U X;  1KAY A;  2GL1 A;  5AQM A;  1GPT A;  5BPM A;  1ICA A;  1HX1 A;  2MZ0 A;  3GL1 A;  3QI7 A;  5AQK A;  1ZYV A;  1T0Z A;  1S3X A;  1WT7 A;  5AQP A;  1PE4 A;  2QWO A;  3CW4 A;  3E7R L;  3L4I A;  1SN1 A;  3L56 A;  3ATU A;  2KBH A;  4AAZ A;  2E88 A;  1L4V A;  1BMR A;  5AQI A;  2ASC A;  3C7N B;  4HWI A;  1BRZ A;  2GMO A;  1LQH A;  1SN4 A;  1QQM A;  1ZUT A;  3QML A;  5AQQ A;  2QWP A;  1XRS B;  5AQL A;  1OMY A;  2KJA A;  2LN8 A;  3FZK A;  5AQZ A;  3QFP A;  5AQR A;  5EX5 A;  1AHO A;  2KGQ A;  1T7E A;  1VNA A;  2E3F A;  2YC1 C;  3AY9 A;  3M3Z A;  4KYP A;  1NPI A;  2LR3 A;  3FZF A;  1HPM A;  1PTX A;  2QWR A;  3D2F A;  1NGD A;  2E0H A; 
#chains in the Genus database with same CATH homology
 1ZVE A;  4AB0 A;  1MYN A;  2KBK A;  2LY6 A;  1NRB A;  1NE5 A;  1WWN A;  2N66 A;  2LJM A;  1I2U A;  1LQI A;  1BK8 A;  2LT8 A;  1T7B A;  2YEO A;  2N2Q A;  1PX9 A;  2LKB A;  1VNB A;  2KSK A;  1ZYW A;  2NY8 X;  1ZFU A;  1AYJ A;  1ZVG A;  5CY0 A;  2N2R A;  2B3C A;  2I61 A;  1P0A A;  1T7A A;  2KYQ A;  2N69 A;  1JXC A;  1N4N A;  2SN3 A;  2B68 A;  1LQQ A;  1ZU3 A;  1T1T A;  1I6G A;  1KV0 A;  1B3C A;  2YBR C;  1DJT A;  1CHZ A;  2ATB A;  4CQK A;  1NH5 A;  1P00 A;  1I6F A;  2BRZ A;  1WMT A;  1JKZ A;  1FH3 A;  1DQ7 A;  5KK4 A;  2E3G A;  4V1D C;  1C56 A;  1TI5 A;  4HE7 A;  1SNB A;  1OZZ A;  4AEI A;  2A7T A;  1SEG A;  1JZB A;  2LI7 A;  1MR4 A;  2M8B B;  2LJ7 A;  2LY5 A;  4HHF A;  2KBJ A;  4UJ0 A;  3PSM A;  1NRA A;  1CN2 A;  1BCG A;  1JZA A;  1B7D A;  2NY9 X;  1C55 A;  1GPS A;  1I2V A;  1GPT A;  2KPY A;  3E7U X;  2GL1 A;  1ICA A;  2MZ0 A;  1ZYV A;  1T0Z A;  1WT7 A;  1PE4 A;  3E7R L;  1SN1 A;  2KBH A;  4AAZ A;  1L4V A;  1BMR A;  2ASC A;  1BRZ A;  1LQH A;  1SN4 A;  1ZUT A;  1OMY A;  2KJA A;  1AHO A;  2KGQ A;  1T7E A;  1VNA A;  2E3F A;  2YC1 C;  4KYP A;  1NPI A;  2LR3 A;  1PTX A;  2E0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...