2E0HA

Solution structure of bmkalphait01, an alpha-insect toxin from the venom of the chinese scorpion buthus martensi karsch
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
64
structure length
64
Chain Sequence
VRDAYIAQNYNCVYHCARDAYCNELCTKNGAKSGSCPYLGEHKFACYCKDLPDNVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Alpha-neurotoxin TX12
publication title Solution Structure of BmKalphaIT01, an alpha-Insect Toxin from the Venom of the Chinese Scorpion Buthus martensii Karsch
pubmed doi rcsb
total genus 19
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2006-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2e0hA00
1ZVEA 1B7DA 1OZZA 2LR3A 1ZYWA 2NY8X 4HHFA 2LY5A 1OMYA 2E0HA 1I2UA 1CHZA 1ZU3A 1TI5A 1JZAA 4AAZA 1N4NA 1FH3A 2N2RA 1BCGA 1NRAA 1P0AA 2KJAA 2A7TA 1AHOA 3E7RL 2KPYA 1KV0A 2N66A 2M8BB 1MYNA 2KBJA 1DQ7A 1ZUTA 2LY6A 2NY9X 2ASCA 2KGQA 2MZ0A 1L4VA 1ZVGA 2LT8A 2KSKA 4CQKA 2LJMA 1WMTA 1GPSA 4AB0A 1DJTA 1PTXA 1GPTA 2B68A 1WWNA 1JKZA 2KYQA 1B3CA 2ATBA 2E3FA 1AYJA 2KBHA 1I2VA 1VNBA 1BRZA 1SNBA 1ZYVA 1ICAA 1NH5A 2N69A 2B3CA 2LKBA 1CN2A 1SN1A 1SN4A 2GL1A 5KK4A 2YEOA 2I61A 1T0ZA 4V1DC 1ZFUA 1BMRA 4KYPA 1JZBA 3PSMA 1I6GA 2E3GA 4AEIA 1C56A 1PE4A 1I6FA 1NPIA 2LJ7A 1BK8A 4UJ0A 1PX9A 1MR4A 1VNAA 2YC1C 1JXCA 1LQHA 2BRZA 1P00A 1NRBA 1SEGA 2YBRC 1C55A 1T1TA 1NE5A 1LQIA 2KBKA 1LQQA 1T7AA 2LI7A 2N2QA 5CY0A 3E7UX 2SN3A 1T7EA 1T7BA 1WT7A 4HE7A
chains in the Genus database with same CATH superfamily
3QI7A 1ZVEA 3ATVA 3L56A 3QMLA 3BK3C 5AQZA 4IO8A 5FPMA 1B7DA 1NGGA 1OZZA 5AQFA 1ATRA 3FE1A 5BPMA 1NGHA 1POIA 5AQYA 2LR3A 1ZYWA 1ATSA 1KAYA 2NY8X 2E88A 2QWLA 4HHFA 2LY5A 3GDQA 1OMYA 3R2VA 1XRSB 3KOXA 3CW4A 2E0HA 1I2UA 4H5TA 3FZKA 4UAEF 3I33A 3KHWA 5EVZA 1KAZA 1CHZA 1ZU3A 5AQVA 1TI5A 1JZAA 1QQMA 3CQXA 1N4NA 2LN8A 1UGLA 4AAZA 5AQRA 1HPMA 3KP0A 2N2RA 2QXLA 1BCGA 3QFPA 1KAXA 1NRAA 2E8AA 1P0AA 2QW9A 3AY9A 5AQQA 5BPNA 2KJAA 5FPEA 1NGIA 2A7TA 1QQNA 4H5VA 1AHOA 3E7RL 3C7NB 2KPYA 2QWRA 4H5NA 1KV0A 3FZFA 2N66A 1NGCA 2M8BB 1MYNA 4KBOA 2KBJA 1DQ7A 1ZUTA 3D2FB 2LY6A 2QWNA 5F0XA 2BUPA 3KOYA 2NY9X 2ASCA 2KGQA 2MZ0A 2QWOA 1ZVGA 2LT8A 1BUPA 2D56A 2KSKA 3D2EA 5AQKA 4CQKA 2LJMA 1K8BA 5BN8A 1WMTA 3LDQA 5FPDA 1GPSA 3SF4D 5AR0A 4AB0A 1DJTA 1PTXA 1GPTA 1S3XA 2MN5A 5AQLA 2YILA 2B68A 1WWNA 1NGFA 2QWQA 1JKZA 2KYQA 2QWPA 3FZLA 5F1XA 2ATBA 2E3FA 2G2KA 1NGAA 3GKUA 3KOZA 5AQUA 4UAFE 2V7ZA 1HX1A 1AYJA 5AQXA 2KBHA 1I2VA 1VNBA 1BRZA 1SNBA 1NGBA 3KVGA 1ZYVA 5AQNA 3IUCA 1NGDA 1ICAA 1NH5A 2N69A 2B3CA 2LKBA 2YIOA 4GNIA 1CN2A 3D2EB 1SN1A 3QFUA 1SN4A 2GL1A 3HSCA 5KK4A 3KP1A 5BPLA 3JXUA 3FZMA 2YEOA 2I61A 3L4IA 2KHOA 1T0ZA 2JDQD 4V1DC 1ZFUA 3KOWA 1BMRA 4KYPA 1JZBA 5AQWA 3PSMA 4FL9A 5AQJA 1I6GA 2E3GA 2MBKA 3C7NA 4AEIA 1HJOA 1C56A 4H5WA 1PE4A 3A8YA 5AQMA 1I6FA 5AQIA 5FPNA 4HWIA 5BN9A 1NGJA 3KC6A 1NPIA 2LJ7A 5AQGA 1BK8A 5EX5A 1DKGD 4FSVA 4UJ0A 1PX9A 1MR4A 2GMOA 3D2FA 1QQOA 1FH3A 5EXWA 5AQTA 5AQOA 1VNAA 1YUWA 2YC1C 2K35A 1B3CA 4UADE 3GL1A 3LDLA 3FZHA 3M3ZA 1JXCA 5AQHA 1LQHA 2BRZA 3LDOA 2YIPA 4H5RA 5AQSA 1P00A 1BA1A 1NRBA 1SEGA 1BA0A 3L6QA 2E2FA 2YBRC 1C55A 2VY6A 5EY4A 1NGEA 1T1TA 1NE5A 1LQIA 2KBKA 3LDNA 3LDPA 5F2RA 1LQQA 1T7AA 1L4VA 2LI7A 3ATUA 2QWMA 2N2QA 5CY0A 3E7UX 2SN3A 1T7EA 1T7BA 5AQPA 1WT7A 4HE7A
chains in the Genus database with same CATH topology
1ZVEA 1B7DA 1OZZA 2LR3A 1ZYWA 2NY8X 4HHFA 2LY5A 1OMYA 2E0HA 1I2UA 1CHZA 1ZU3A 1TI5A 1JZAA 4AAZA 1N4NA 1FH3A 2N2RA 1BCGA 1NRAA 1P0AA 2KJAA 2A7TA 1AHOA 3E7RL 2KPYA 1KV0A 2N66A 2M8BB 1MYNA 2KBJA 1DQ7A 1ZUTA 2LY6A 2NY9X 2ASCA 2KGQA 2MZ0A 1L4VA 1ZVGA 2LT8A 2KSKA 4CQKA 2LJMA 1WMTA 1GPSA 4AB0A 1DJTA 1PTXA 1GPTA 2B68A 1WWNA 1JKZA 2KYQA 1B3CA 2ATBA 2E3FA 1AYJA 2KBHA 1I2VA 1VNBA 1BRZA 1SNBA 1ZYVA 1ICAA 1NH5A 2N69A 2B3CA 2LKBA 1CN2A 1SN1A 1SN4A 2GL1A 5KK4A 2YEOA 2I61A 1T0ZA 4V1DC 1ZFUA 1BMRA 4KYPA 1JZBA 3PSMA 1I6GA 2E3GA 4AEIA 1C56A 1PE4A 1I6FA 1NPIA 2LJ7A 1BK8A 4UJ0A 1PX9A 1MR4A 1VNAA 2YC1C 1JXCA 1LQHA 2BRZA 1P00A 1NRBA 1SEGA 2YBRC 1C55A 1T1TA 1NE5A 1LQIA 2KBKA 1LQQA 1T7AA 2LI7A 2N2QA 5CY0A 3E7UX 2SN3A 1T7EA 1T7BA 1WT7A 4HE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZVE A;  1B7D A;  1OZZ A;  2LR3 A;  1ZYW A;  2NY8 X;  4HHF A;  2LY5 A;  1OMY A;  2E0H A;  1I2U A;  1CHZ A;  1ZU3 A;  1TI5 A;  1JZA A;  4AAZ A;  1N4N A;  1FH3 A;  2N2R A;  1BCG A;  1NRA A;  1P0A A;  2KJA A;  2A7T A;  1AHO A;  3E7R L;  2KPY A;  1KV0 A;  2N66 A;  2M8B B;  1MYN A;  2KBJ A;  1DQ7 A;  1ZUT A;  2LY6 A;  2NY9 X;  2ASC A;  2KGQ A;  2MZ0 A;  1L4V A;  1ZVG A;  2LT8 A;  2KSK A;  4CQK A;  2LJM A;  1WMT A;  1GPS A;  4AB0 A;  1DJT A;  1PTX A;  1GPT A;  2B68 A;  1WWN A;  1JKZ A;  2KYQ A;  1B3C A;  2ATB A;  2E3F A;  1AYJ A;  2KBH A;  1I2V A;  1VNB A;  1BRZ A;  1SNB A;  1ZYV A;  1ICA A;  1NH5 A;  2N69 A;  2B3C A;  2LKB A;  1CN2 A;  1SN1 A;  1SN4 A;  2GL1 A;  5KK4 A;  2YEO A;  2I61 A;  1T0Z A;  4V1D C;  1ZFU A;  1BMR A;  4KYP A;  1JZB A;  3PSM A;  1I6G A;  2E3G A;  4AEI A;  1C56 A;  1PE4 A;  1I6F A;  1NPI A;  2LJ7 A;  1BK8 A;  4UJ0 A;  1PX9 A;  1MR4 A;  1VNA A;  2YC1 C;  1JXC A;  1LQH A;  2BRZ A;  1P00 A;  1NRB A;  1SEG A;  2YBR C;  1C55 A;  1T1T A;  1NE5 A;  1LQI A;  2KBK A;  1LQQ A;  1T7A A;  2LI7 A;  2N2Q A;  5CY0 A;  3E7U X;  2SN3 A;  1T7E A;  1T7B A;  1WT7 A;  4HE7 A; 
#chains in the Genus database with same CATH topology
 3QI7 A;  1ZVE A;  3ATV A;  3L56 A;  3QML A;  3BK3 C;  5AQZ A;  4IO8 A;  5FPM A;  1B7D A;  1NGG A;  1OZZ A;  5AQF A;  1ATR A;  3FE1 A;  5BPM A;  1NGH A;  1POI A;  5AQY A;  2LR3 A;  1ZYW A;  1ATS A;  1KAY A;  2NY8 X;  2E88 A;  2QWL A;  4HHF A;  2LY5 A;  3GDQ A;  1OMY A;  3R2V A;  1XRS B;  3KOX A;  3CW4 A;  2E0H A;  1I2U A;  4H5T A;  3FZK A;  4UAE F;  3I33 A;  3KHW A;  5EVZ A;  1KAZ A;  1CHZ A;  1ZU3 A;  5AQV A;  1TI5 A;  1JZA A;  1QQM A;  3CQX A;  1N4N A;  2LN8 A;  1UGL A;  4AAZ A;  5AQR A;  1HPM A;  3KP0 A;  2N2R A;  2QXL A;  1BCG A;  3QFP A;  1KAX A;  1NRA A;  2E8A A;  1P0A A;  2QW9 A;  3AY9 A;  5AQQ A;  5BPN A;  2KJA A;  5FPE A;  1NGI A;  2A7T A;  1QQN A;  4H5V A;  1AHO A;  3E7R L;  3C7N B;  2KPY A;  2QWR A;  4H5N A;  1KV0 A;  3FZF A;  2N66 A;  1NGC A;  2M8B B;  1MYN A;  4KBO A;  2KBJ A;  1DQ7 A;  1ZUT A;  3D2F B;  2LY6 A;  2QWN A;  5F0X A;  2BUP A;  3KOY A;  2NY9 X;  2ASC A;  2KGQ A;  2MZ0 A;  2QWO A;  1ZVG A;  2LT8 A;  1BUP A;  2D56 A;  2KSK A;  3D2E A;  5AQK A;  4CQK A;  2LJM A;  1K8B A;  5BN8 A;  1WMT A;  3LDQ A;  5FPD A;  1GPS A;  3SF4 D;  5AR0 A;  4AB0 A;  1DJT A;  1PTX A;  1GPT A;  1S3X A;  2MN5 A;  5AQL A;  2YIL A;  2B68 A;  1WWN A;  1NGF A;  2QWQ A;  1JKZ A;  2KYQ A;  2QWP A;  3FZL A;  5F1X A;  2ATB A;  2E3F A;  2G2K A;  1NGA A;  3GKU A;  3KOZ A;  5AQU A;  4UAF E;  2V7Z A;  1HX1 A;  1AYJ A;  5AQX A;  2KBH A;  1I2V A;  1VNB A;  1BRZ A;  1SNB A;  1NGB A;  3KVG A;  1ZYV A;  5AQN A;  3IUC A;  1NGD A;  1ICA A;  1NH5 A;  2N69 A;  2B3C A;  2LKB A;  2YIO A;  4GNI A;  1CN2 A;  3D2E B;  1SN1 A;  3QFU A;  1SN4 A;  2GL1 A;  3HSC A;  5KK4 A;  3KP1 A;  5BPL A;  3JXU A;  3FZM A;  2YEO A;  2I61 A;  3L4I A;  2KHO A;  1T0Z A;  2JDQ D;  4V1D C;  1ZFU A;  3KOW A;  1BMR A;  4KYP A;  1JZB A;  5AQW A;  3PSM A;  4FL9 A;  5AQJ A;  1I6G A;  2E3G A;  2MBK A;  3C7N A;  4AEI A;  1HJO A;  1C56 A;  4H5W A;  1PE4 A;  3A8Y A;  5AQM A;  1I6F A;  5AQI A;  5FPN A;  4HWI A;  5BN9 A;  1NGJ A;  3KC6 A;  1NPI A;  2LJ7 A;  5AQG A;  1BK8 A;  5EX5 A;  1DKG D;  4FSV A;  4UJ0 A;  1PX9 A;  1MR4 A;  2GMO A;  3D2F A;  1QQO A;  1FH3 A;  5EXW A;  5AQT A;  5AQO A;  1VNA A;  1YUW A;  2YC1 C;  2K35 A;  1B3C A;  4UAD E;  3GL1 A;  3LDL A;  3FZH A;  3M3Z A;  1JXC A;  5AQH A;  1LQH A;  2BRZ A;  3LDO A;  2YIP A;  4H5R A;  5AQS A;  1P00 A;  1BA1 A;  1NRB A;  1SEG A;  1BA0 A;  3L6Q A;  2E2F A;  2YBR C;  1C55 A;  2VY6 A;  5EY4 A;  1NGE A;  1T1T A;  1NE5 A;  1LQI A;  2KBK A;  3LDN A;  3LDP A;  5F2R A;  1LQQ A;  1T7A A;  1L4V A;  2LI7 A;  3ATU A;  2QWM A;  2N2Q A;  5CY0 A;  3E7U X;  2SN3 A;  1T7E A;  1T7B A;  5AQP A;  1WT7 A;  4HE7 A; 
#chains in the Genus database with same CATH homology
 1ZVE A;  1B7D A;  1OZZ A;  2LR3 A;  1ZYW A;  2NY8 X;  4HHF A;  2LY5 A;  1OMY A;  2E0H A;  1I2U A;  1CHZ A;  1ZU3 A;  1TI5 A;  1JZA A;  4AAZ A;  1N4N A;  1FH3 A;  2N2R A;  1BCG A;  1NRA A;  1P0A A;  2KJA A;  2A7T A;  1AHO A;  3E7R L;  2KPY A;  1KV0 A;  2N66 A;  2M8B B;  1MYN A;  2KBJ A;  1DQ7 A;  1ZUT A;  2LY6 A;  2NY9 X;  2ASC A;  2KGQ A;  2MZ0 A;  1L4V A;  1ZVG A;  2LT8 A;  2KSK A;  4CQK A;  2LJM A;  1WMT A;  1GPS A;  4AB0 A;  1DJT A;  1PTX A;  1GPT A;  2B68 A;  1WWN A;  1JKZ A;  2KYQ A;  1B3C A;  2ATB A;  2E3F A;  1AYJ A;  2KBH A;  1I2V A;  1VNB A;  1BRZ A;  1SNB A;  1ZYV A;  1ICA A;  1NH5 A;  2N69 A;  2B3C A;  2LKB A;  1CN2 A;  1SN1 A;  1SN4 A;  2GL1 A;  5KK4 A;  2YEO A;  2I61 A;  1T0Z A;  4V1D C;  1ZFU A;  1BMR A;  4KYP A;  1JZB A;  3PSM A;  1I6G A;  2E3G A;  4AEI A;  1C56 A;  1PE4 A;  1I6F A;  1NPI A;  2LJ7 A;  1BK8 A;  4UJ0 A;  1PX9 A;  1MR4 A;  1VNA A;  2YC1 C;  1JXC A;  1LQH A;  2BRZ A;  1P00 A;  1NRB A;  1SEG A;  2YBR C;  1C55 A;  1T1T A;  1NE5 A;  1LQI A;  2KBK A;  1LQQ A;  1T7A A;  2LI7 A;  2N2Q A;  5CY0 A;  3E7U X;  2SN3 A;  1T7E A;  1T7B A;  1WT7 A;  4HE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...