1CN2A

Solution structure of toxin 2 from centruroides noxius hoffmann, a beta scorpion neurotoxin acting on sodium channels, nmr, 15 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
b'KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TOXIN 2
publication title Solution structure of toxin 2 from centruroides noxius Hoffmann, a beta-scorpion neurotoxin acting on sodium channels.
pubmed doi rcsb
molecule tags Neurotoxin
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1cn2A00
1ZYVA 1T0ZA 1SN1A 2E3GA 4AB0A 2KBKA 2KGQA 1WMTA 4V1DC 2N2QA 1BRZA 2N69A 1B3CA 4AEIA 1FH3A 1ZFUA 2LKBA 1SNBA 1DQ7A 1ZVGA 1I6GA 3E7RL 1VNAA 1NH5A 2KBJA 2LI7A 1NRBA 1NRAA 1BMRA 2LY5A 1PE4A 2LJ7A 1ZYWA 4UJ0A 1P0AA 1ZUTA 2GL1A 1SEGA 1JZBA 1CN2A 2NY8X 2E0HA 5KK4A 2KJAA 2KPYA 1JKZA 4HHFA 2BRZA 1ZVEA 5CY0A 1N4NA 2SN3A 2YBRC 1CHZA 2N66A 1NE5A 2KBHA 1NPIA 1PTXA 3PSMA 2LT8A 1DJTA 1I6FA 4CQKA 2LR3A 1P00A 2I61A 1VNBA 2NY9X 1T7BA 2N2RA 1KV0A 2E3FA 4HE7A 2ATBA 2ASCA 1T7AA 2YEOA 2KSKA 2KYQA 4KYPA 1B7DA 1T7EA 2A7TA 1JZAA 1AYJA 1AHOA 2MZ0A 4AAZA 1C55A 1WT7A 1GPSA 1PX9A 1ZU3A 1I2UA 1SN4A 1OZZA 2B3CA 1GPTA 1C56A 3E7UX 1MYNA 1MR4A 2M8BB 1I2VA 2LY6A 1TI5A 2YC1C 1L4VA 1LQHA 2B68A 1LQQA 1LQIA 1ICAA 1BCGA 1WWNA 1JXCA 1OMYA 1BK8A 1T1TA 2LJMA
chains in the Genus database with same CATH superfamily
5EY4A 1ZYVA 1T0ZA 1SN1A 2KHOA 2E3GA 5AQYA 2MBKA 5AQTA 4AB0A 1ATSA 1NGAA 2KBKA 2G2KA 4FSVA 1NGEA 2KGQA 1WMTA 5AQNA 4V1DC 5AQRA 2QWRA 2GMOA 3FE1A 2N2QA 3KOZA 3L56A 1BRZA 2N69A 2QWOA 4KBOA 1B3CA 4AEIA 3R2VA 2QXLA 3JXUA 1FH3A 1QQNA 1ZFUA 2MN5A 2LKBA 1SNBA 5BPNA 1DQ7A 3FZLA 1ZVGA 5AQJA 1I6GA 3E7RL 1BA1A 1POIA 1VNAA 5AQPA 1NH5A 2E88A 2KBJA 3ATVA 1NGGA 2QWQA 5AQSA 2JDQD 2LI7A 3D2EB 1XRSB 3KHWA 1NRBA 1NRAA 3LDOA 1BMRA 1NGHA 1PE4A 1KAYA 2LY5A 2QWPA 1GPSA 2LJ7A 5F1XA 5AQVA 5FPNA 1ZYWA 4UJ0A 5AQFA 1P0AA 2YILA 1ZUTA 1NGIA 1SEGA 1JZBA 1YUWA 2BUPA 2GL1A 3A8YA 2D56A 1CN2A 2NY8X 2E0HA 5KK4A 2E2FA 1BA0A 3FZHA 3FZFA 2KJAA 2KPYA 3QI7A 2QW9A 1JKZA 4HHFA 2BRZA 2YIPA 1ZVEA 1KAXA 5BN9A 5CY0A 5AQGA 1N4NA 2K35A 2SN3A 2YBRC 4UAEF 3C7NB 1CHZA 5AQLA 5EXWA 2N66A 5AQZA 3SF4D 1NE5A 2E8AA 4HWIA 5AQXA 2LN8A 2KBHA 5AQHA 1HPMA 3FZMA 1NPIA 1PTXA 3PSMA 2LT8A 1DJTA 1I6FA 3CQXA 5F2RA 4CQKA 2LR3A 3QFPA 5BPLA 5FPDA 3ATUA 1P00A 1HX1A 2QWNA 1VNBA 2I61A 2V7ZA 4H5NA 2NY9X 1K8BA 4H5WA 3GDQA 4H5TA 4H5RA 1HJOA 3LDNA 1T7BA 2N2RA 1KV0A 2E3FA 3D2FB 2VY6A 5FPMA 3C7NA 1NGBA 3L4IA 4HE7A 1KAZA 5AR0A 2ATBA 2ASCA 5FPEA 2QWMA 1T7AA 3LDQA 1NGJA 1NGDA 3M3ZA 5EVZA 2YEOA 2YIOA 3HSCA 2KSKA 3D2EA 4UADE 5BPMA 2KYQA 4KYPA 1B7DA 1T7EA 5AQOA 2A7TA 3L6QA 5BN8A 1JZAA 1AYJA 4H5VA 1AHOA 2MZ0A 3LDLA 4AAZA 1C55A 1WT7A 1QQMA 3KOWA 1QQOA 1PX9A 3D2FA 3KP0A 5AQMA 5AQUA 1BUPA 1ZU3A 3GKUA 5EX5A 1I2UA 1SN4A 3GL1A 1OZZA 2B3CA 1ATRA 3AY9A 1UGLA 1NGFA 5AQKA 1GPTA 1S3XA 4GNIA 1C56A 3KOYA 3E7UX 3KVGA 5F0XA 1MYNA 3KC6A 1MR4A 4UAFE 3IUCA 2M8BB 2QWLA 1I2VA 2LY6A 1TI5A 2YC1C 3I33A 3KOXA 1LQHA 1L4VA 4FL9A 2B68A 5AQQA 1LQQA 3KP1A 1NGCA 1LQIA 3BK3C 1ICAA 1BCGA 5AQIA 1DKGD 1WWNA 3LDPA 3QMLA 3FZKA 1JXCA 3QFUA 1OMYA 4IO8A 5AQWA 3CW4A 1T1TA 2LJMA 1BK8A
chains in the Genus database with same CATH topology
1ZYVA 1T0ZA 1SN1A 2E3GA 4AB0A 2KBKA 2KGQA 1WMTA 4V1DC 2N2QA 1BRZA 2N69A 1B3CA 4AEIA 1FH3A 1ZFUA 2LKBA 1SNBA 1DQ7A 1ZVGA 1I6GA 3E7RL 1VNAA 1NH5A 2KBJA 2LI7A 1NRBA 1NRAA 1BMRA 2LY5A 1PE4A 2LJ7A 1ZYWA 4UJ0A 1P0AA 1ZUTA 2GL1A 1SEGA 1JZBA 1CN2A 2NY8X 2E0HA 5KK4A 2KJAA 2KPYA 1JKZA 4HHFA 2BRZA 1ZVEA 5CY0A 1N4NA 2SN3A 2YBRC 1CHZA 2N66A 1NE5A 2KBHA 1NPIA 1PTXA 3PSMA 2LT8A 1DJTA 1I6FA 4CQKA 2LR3A 1P00A 2I61A 1VNBA 2NY9X 1T7BA 2N2RA 1KV0A 2E3FA 4HE7A 2ATBA 2ASCA 1T7AA 2YEOA 2KSKA 2KYQA 4KYPA 1B7DA 1T7EA 2A7TA 1JZAA 1AYJA 1AHOA 2MZ0A 4AAZA 1C55A 1WT7A 1GPSA 1PX9A 1ZU3A 1I2UA 1SN4A 1OZZA 2B3CA 1GPTA 1C56A 3E7UX 1MYNA 1MR4A 2M8BB 1I2VA 2LY6A 1TI5A 2YC1C 1L4VA 1LQHA 2B68A 1LQQA 1LQIA 1ICAA 1BCGA 1WWNA 1JXCA 1OMYA 1BK8A 1T1TA 2LJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZYV A;  1T0Z A;  1SN1 A;  2E3G A;  4AB0 A;  2KBK A;  2KGQ A;  1WMT A;  4V1D C;  2N2Q A;  1BRZ A;  2N69 A;  1B3C A;  4AEI A;  1FH3 A;  1ZFU A;  2LKB A;  1SNB A;  1DQ7 A;  1ZVG A;  1I6G A;  3E7R L;  1VNA A;  1NH5 A;  2KBJ A;  2LI7 A;  1NRB A;  1NRA A;  1BMR A;  2LY5 A;  1PE4 A;  2LJ7 A;  1ZYW A;  4UJ0 A;  1P0A A;  1ZUT A;  2GL1 A;  1SEG A;  1JZB A;  1CN2 A;  2NY8 X;  2E0H A;  5KK4 A;  2KJA A;  2KPY A;  1JKZ A;  4HHF A;  2BRZ A;  1ZVE A;  5CY0 A;  1N4N A;  2SN3 A;  2YBR C;  1CHZ A;  2N66 A;  1NE5 A;  2KBH A;  1NPI A;  1PTX A;  3PSM A;  2LT8 A;  1DJT A;  1I6F A;  4CQK A;  2LR3 A;  1P00 A;  2I61 A;  1VNB A;  2NY9 X;  1T7B A;  2N2R A;  1KV0 A;  2E3F A;  4HE7 A;  2ATB A;  2ASC A;  1T7A A;  2YEO A;  2KSK A;  2KYQ A;  4KYP A;  1B7D A;  1T7E A;  2A7T A;  1JZA A;  1AYJ A;  1AHO A;  2MZ0 A;  4AAZ A;  1C55 A;  1WT7 A;  1GPS A;  1PX9 A;  1ZU3 A;  1I2U A;  1SN4 A;  1OZZ A;  2B3C A;  1GPT A;  1C56 A;  3E7U X;  1MYN A;  1MR4 A;  2M8B B;  1I2V A;  2LY6 A;  1TI5 A;  2YC1 C;  1L4V A;  1LQH A;  2B68 A;  1LQQ A;  1LQI A;  1ICA A;  1BCG A;  1WWN A;  1JXC A;  1OMY A;  1BK8 A;  1T1T A;  2LJM A; 
#chains in the Genus database with same CATH topology
 5EY4 A;  1ZYV A;  1T0Z A;  1SN1 A;  2KHO A;  2E3G A;  5AQY A;  2MBK A;  5AQT A;  4AB0 A;  1ATS A;  1NGA A;  2KBK A;  2G2K A;  4FSV A;  1NGE A;  2KGQ A;  1WMT A;  5AQN A;  4V1D C;  5AQR A;  2QWR A;  2GMO A;  3FE1 A;  2N2Q A;  3KOZ A;  3L56 A;  1BRZ A;  2N69 A;  2QWO A;  4KBO A;  1B3C A;  4AEI A;  3R2V A;  2QXL A;  3JXU A;  1FH3 A;  1QQN A;  1ZFU A;  2MN5 A;  2LKB A;  1SNB A;  5BPN A;  1DQ7 A;  3FZL A;  1ZVG A;  5AQJ A;  1I6G A;  3E7R L;  1BA1 A;  1POI A;  1VNA A;  5AQP A;  1NH5 A;  2E88 A;  2KBJ A;  3ATV A;  1NGG A;  2QWQ A;  5AQS A;  2JDQ D;  2LI7 A;  3D2E B;  1XRS B;  3KHW A;  1NRB A;  1NRA A;  3LDO A;  1BMR A;  1NGH A;  1PE4 A;  1KAY A;  2LY5 A;  2QWP A;  1GPS A;  2LJ7 A;  5F1X A;  5AQV A;  5FPN A;  1ZYW A;  4UJ0 A;  5AQF A;  1P0A A;  2YIL A;  1ZUT A;  1NGI A;  1SEG A;  1JZB A;  1YUW A;  2BUP A;  2GL1 A;  3A8Y A;  2D56 A;  1CN2 A;  2NY8 X;  2E0H A;  5KK4 A;  2E2F A;  1BA0 A;  3FZH A;  3FZF A;  2KJA A;  2KPY A;  3QI7 A;  2QW9 A;  1JKZ A;  4HHF A;  2BRZ A;  2YIP A;  1ZVE A;  1KAX A;  5BN9 A;  5CY0 A;  5AQG A;  1N4N A;  2K35 A;  2SN3 A;  2YBR C;  4UAE F;  3C7N B;  1CHZ A;  5AQL A;  5EXW A;  2N66 A;  5AQZ A;  3SF4 D;  1NE5 A;  2E8A A;  4HWI A;  5AQX A;  2LN8 A;  2KBH A;  5AQH A;  1HPM A;  3FZM A;  1NPI A;  1PTX A;  3PSM A;  2LT8 A;  1DJT A;  1I6F A;  3CQX A;  5F2R A;  4CQK A;  2LR3 A;  3QFP A;  5BPL A;  5FPD A;  3ATU A;  1P00 A;  1HX1 A;  2QWN A;  1VNB A;  2I61 A;  2V7Z A;  4H5N A;  2NY9 X;  1K8B A;  4H5W A;  3GDQ A;  4H5T A;  4H5R A;  1HJO A;  3LDN A;  1T7B A;  2N2R A;  1KV0 A;  2E3F A;  3D2F B;  2VY6 A;  5FPM A;  3C7N A;  1NGB A;  3L4I A;  4HE7 A;  1KAZ A;  5AR0 A;  2ATB A;  2ASC A;  5FPE A;  2QWM A;  1T7A A;  3LDQ A;  1NGJ A;  1NGD A;  3M3Z A;  5EVZ A;  2YEO A;  2YIO A;  3HSC A;  2KSK A;  3D2E A;  4UAD E;  5BPM A;  2KYQ A;  4KYP A;  1B7D A;  1T7E A;  5AQO A;  2A7T A;  3L6Q A;  5BN8 A;  1JZA A;  1AYJ A;  4H5V A;  1AHO A;  2MZ0 A;  3LDL A;  4AAZ A;  1C55 A;  1WT7 A;  1QQM A;  3KOW A;  1QQO A;  1PX9 A;  3D2F A;  3KP0 A;  5AQM A;  5AQU A;  1BUP A;  1ZU3 A;  3GKU A;  5EX5 A;  1I2U A;  1SN4 A;  3GL1 A;  1OZZ A;  2B3C A;  1ATR A;  3AY9 A;  1UGL A;  1NGF A;  5AQK A;  1GPT A;  1S3X A;  4GNI A;  1C56 A;  3KOY A;  3E7U X;  3KVG A;  5F0X A;  1MYN A;  3KC6 A;  1MR4 A;  4UAF E;  3IUC A;  2M8B B;  2QWL A;  1I2V A;  2LY6 A;  1TI5 A;  2YC1 C;  3I33 A;  3KOX A;  1LQH A;  1L4V A;  4FL9 A;  2B68 A;  5AQQ A;  1LQQ A;  3KP1 A;  1NGC A;  1LQI A;  3BK3 C;  1ICA A;  1BCG A;  5AQI A;  1DKG D;  1WWN A;  3LDP A;  3QML A;  3FZK A;  1JXC A;  3QFU A;  1OMY A;  4IO8 A;  5AQW A;  3CW4 A;  1T1T A;  2LJM A;  1BK8 A; 
#chains in the Genus database with same CATH homology
 1ZYV A;  1T0Z A;  1SN1 A;  2E3G A;  4AB0 A;  2KBK A;  2KGQ A;  1WMT A;  4V1D C;  2N2Q A;  1BRZ A;  2N69 A;  1B3C A;  4AEI A;  1FH3 A;  1ZFU A;  2LKB A;  1SNB A;  1DQ7 A;  1ZVG A;  1I6G A;  3E7R L;  1VNA A;  1NH5 A;  2KBJ A;  2LI7 A;  1NRB A;  1NRA A;  1BMR A;  2LY5 A;  1PE4 A;  2LJ7 A;  1ZYW A;  4UJ0 A;  1P0A A;  1ZUT A;  2GL1 A;  1SEG A;  1JZB A;  1CN2 A;  2NY8 X;  2E0H A;  5KK4 A;  2KJA A;  2KPY A;  1JKZ A;  4HHF A;  2BRZ A;  1ZVE A;  5CY0 A;  1N4N A;  2SN3 A;  2YBR C;  1CHZ A;  2N66 A;  1NE5 A;  2KBH A;  1NPI A;  1PTX A;  3PSM A;  2LT8 A;  1DJT A;  1I6F A;  4CQK A;  2LR3 A;  1P00 A;  2I61 A;  1VNB A;  2NY9 X;  1T7B A;  2N2R A;  1KV0 A;  2E3F A;  4HE7 A;  2ATB A;  2ASC A;  1T7A A;  2YEO A;  2KSK A;  2KYQ A;  4KYP A;  1B7D A;  1T7E A;  2A7T A;  1JZA A;  1AYJ A;  1AHO A;  2MZ0 A;  4AAZ A;  1C55 A;  1WT7 A;  1GPS A;  1PX9 A;  1ZU3 A;  1I2U A;  1SN4 A;  1OZZ A;  2B3C A;  1GPT A;  1C56 A;  3E7U X;  1MYN A;  1MR4 A;  2M8B B;  1I2V A;  2LY6 A;  1TI5 A;  2YC1 C;  1L4V A;  1LQH A;  2B68 A;  1LQQ A;  1LQI A;  1ICA A;  1BCG A;  1WWN A;  1JXC A;  1OMY A;  1BK8 A;  1T1T A;  2LJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...