1UGLA

Solution structure of s8-sp11
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
50
Chain Sequence
b'NLMKRCTRGFRKLGKCTTLEEEKCKTLYPRGQCTCSDSKMNTHSCDCKSC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-locus pollen protein
publication title Structure of the Male Determinant Factor for Brassica Self-incompatibility
pubmed doi rcsb
molecule tags Plant protein
total genus 7
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2003-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.70 Alpha Beta 2-Layer Sandwich Defensin A-like Scorpion toxin-like 1uglA00
1UGLA
chains in the Genus database with same CATH superfamily
4H5RA 3KVGA 5AQGA 2M8BB 1B7DA 1KV0A 2N2RA 2ATBA 4CQKA 1ZVEA 3M3ZA 2MN5A 5EY4A 1MR4A 1DKGD 3L56A 5AQZA 2YEOA 3HSCA 4IO8A 1OMYA 4AAZA 2NY9X 3ATVA 1AYJA 5AQXA 1BUPA 3KOWA 1GPSA 3D2FB 1CN2A 3KOYA 1NGDA 3PSMA 1I6FA 1QQOA 2E8AA 3FZFA 4FSVA 3SF4D 1ZVGA 3C7NB 4H5TA 1VNBA 1BMRA 2N66A 2QXLA 3LDPA 1NGGA 1I2VA 2V7ZA 1C56A 1NGCA 2KPYA 2QWLA 5AQOA 1T7AA 5AQRA 5AQWA 1NGAA 1P0AA 2I61A 2JDQD 4H5NA 1SEGA 1DQ7A 2QWRA 3L6QA 5AR0A 2KYQA 1WWNA 5EX5A 2QWNA 3QFPA 2VY6A 2E2FA 4UJ0A 3FZHA 2LI7A 5BN9A 2K35A 2E0HA 5F0XA 1SNBA 1HPMA 3A8YA 4GNIA 2NY8X 1JKZA 3KOZA 1DJTA 5FPEA 3LDOA 3QI7A 5AQQA 1HX1A 1ZUTA 1MYNA 1OZZA 2KBKA 4KYPA 5AQTA 1K8BA 5AQLA 3L4IA 3LDLA 2YBRC 3D2EA 2B68A 4FL9A 1NGFA 1BA1A 1ATSA 3I33A 1T0ZA 2KBHA 1ATRA 2N2QA 5AQMA 5AQKA 2QWOA 1LQQA 1NGIA 3KC6A 5AQFA 3FZLA 5FPNA 2QWQA 2LR3A 3IUCA 2A7TA 1BK8A 3GKUA 1XRSB 2E88A 2LY6A 1TI5A 2SN3A 1C55A 1SN1A 1UGLA 2KGQA 5AQUA 3FZKA 2N69A 5F1XA 4UAFE 2YILA 2BRZA 5AQPA 1BRZA 2BUPA 2LKBA 5BPNA 1AHOA 2KJAA 1JXCA 3KOXA 1POIA 1WMTA 2MBKA 4AB0A 5BN8A 1LQHA 2QW9A 3GL1A 1ZFUA 5FPMA 2YIOA 2LJMA 1I6GA 1T7BA 1LQIA 1JZBA 3CQXA 4HE7A 1ZYWA 1I2UA 5AQNA 2YC1C 5AQSA 1QQNA 1NGEA 2B3CA 2KHOA 1QQMA 1P00A 2LJ7A 2MZ0A 3LDQA 3C7NA 2GL1A 4UAEF 5EXWA 1BA0A 2G2KA 4V1DC 3LDNA 5FPDA 1VNAA 1HJOA 1NRAA 2E3FA 4H5VA 3KP0A 3QFUA 5CY0A 1L4VA 2ASCA 2E3GA 4HHFA 3BK3C 3FZMA 3JXUA 1B3CA 1N4NA 3AY9A 1ICAA 5AQJA 1BCGA 2QWPA 1YUWA 2D56A 1CHZA 1ZU3A 2LY5A 4H5WA 1WT7A 5BPLA 2GMOA 2KBJA 4UADE 1JZAA 5F2RA 1NGBA 5AQHA 2YIPA 1T1TA 3D2EB 1PE4A 3GDQA 3KHWA 5AQIA 5BPMA 1KAYA 2LN8A 3ATUA 3E7RL 4HWIA 3KP1A 4KBOA 5EVZA 1GPTA 1NGHA 2KSKA 2LT8A 5KK4A 1NE5A 1T7EA 1SN4A 1KAXA 1PTXA 3E7UX 5AQYA 3D2FA 1S3XA 1PX9A 1NRBA 3QMLA 1NPIA 3CW4A 1KAZA 1NGJA 3FE1A 1ZYVA 5AQVA 1NH5A 2QWMA 3R2VA 1FH3A 4AEIA
chains in the Genus database with same CATH topology
1UGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGL A; 
#chains in the Genus database with same CATH topology
 4H5R A;  3KVG A;  5AQG A;  2M8B B;  1B7D A;  1KV0 A;  2N2R A;  2ATB A;  4CQK A;  1ZVE A;  3M3Z A;  2MN5 A;  5EY4 A;  1MR4 A;  1DKG D;  3L56 A;  5AQZ A;  2YEO A;  3HSC A;  4IO8 A;  1OMY A;  4AAZ A;  2NY9 X;  3ATV A;  1AYJ A;  5AQX A;  1BUP A;  3KOW A;  1GPS A;  3D2F B;  1CN2 A;  3KOY A;  1NGD A;  3PSM A;  1I6F A;  1QQO A;  2E8A A;  3FZF A;  4FSV A;  3SF4 D;  1ZVG A;  3C7N B;  4H5T A;  1VNB A;  1BMR A;  2N66 A;  2QXL A;  3LDP A;  1NGG A;  1I2V A;  2V7Z A;  1C56 A;  1NGC A;  2KPY A;  2QWL A;  5AQO A;  1T7A A;  5AQR A;  5AQW A;  1NGA A;  1P0A A;  2I61 A;  2JDQ D;  4H5N A;  1SEG A;  1DQ7 A;  2QWR A;  3L6Q A;  5AR0 A;  2KYQ A;  1WWN A;  5EX5 A;  2QWN A;  3QFP A;  2VY6 A;  2E2F A;  4UJ0 A;  3FZH A;  2LI7 A;  5BN9 A;  2K35 A;  2E0H A;  5F0X A;  1SNB A;  1HPM A;  3A8Y A;  4GNI A;  2NY8 X;  1JKZ A;  3KOZ A;  1DJT A;  5FPE A;  3LDO A;  3QI7 A;  5AQQ A;  1HX1 A;  1ZUT A;  1MYN A;  1OZZ A;  2KBK A;  4KYP A;  5AQT A;  1K8B A;  5AQL A;  3L4I A;  3LDL A;  2YBR C;  3D2E A;  2B68 A;  4FL9 A;  1NGF A;  1BA1 A;  1ATS A;  3I33 A;  1T0Z A;  2KBH A;  1ATR A;  2N2Q A;  5AQM A;  5AQK A;  2QWO A;  1LQQ A;  1NGI A;  3KC6 A;  5AQF A;  3FZL A;  5FPN A;  2QWQ A;  2LR3 A;  3IUC A;  2A7T A;  1BK8 A;  3GKU A;  1XRS B;  2E88 A;  2LY6 A;  1TI5 A;  2SN3 A;  1C55 A;  1SN1 A;  1UGL A;  2KGQ A;  5AQU A;  3FZK A;  2N69 A;  5F1X A;  4UAF E;  2YIL A;  2BRZ A;  5AQP A;  1BRZ A;  2BUP A;  2LKB A;  5BPN A;  1AHO A;  2KJA A;  1JXC A;  3KOX A;  1POI A;  1WMT A;  2MBK A;  4AB0 A;  5BN8 A;  1LQH A;  2QW9 A;  3GL1 A;  1ZFU A;  5FPM A;  2YIO A;  2LJM A;  1I6G A;  1T7B A;  1LQI A;  1JZB A;  3CQX A;  4HE7 A;  1ZYW A;  1I2U A;  5AQN A;  2YC1 C;  5AQS A;  1QQN A;  1NGE A;  2B3C A;  2KHO A;  1QQM A;  1P00 A;  2LJ7 A;  2MZ0 A;  3LDQ A;  3C7N A;  2GL1 A;  4UAE F;  5EXW A;  1BA0 A;  2G2K A;  4V1D C;  3LDN A;  5FPD A;  1VNA A;  1HJO A;  1NRA A;  2E3F A;  4H5V A;  3KP0 A;  3QFU A;  5CY0 A;  1L4V A;  2ASC A;  2E3G A;  4HHF A;  3BK3 C;  3FZM A;  3JXU A;  1B3C A;  1N4N A;  3AY9 A;  1ICA A;  5AQJ A;  1BCG A;  2QWP A;  1YUW A;  2D56 A;  1CHZ A;  1ZU3 A;  2LY5 A;  4H5W A;  1WT7 A;  5BPL A;  2GMO A;  2KBJ A;  4UAD E;  1JZA A;  5F2R A;  1NGB A;  5AQH A;  2YIP A;  1T1T A;  3D2E B;  1PE4 A;  3GDQ A;  3KHW A;  5AQI A;  5BPM A;  1KAY A;  2LN8 A;  3ATU A;  3E7R L;  4HWI A;  3KP1 A;  4KBO A;  5EVZ A;  1GPT A;  1NGH A;  2KSK A;  2LT8 A;  5KK4 A;  1NE5 A;  1T7E A;  1SN4 A;  1KAX A;  1PTX A;  3E7U X;  5AQY A;  3D2F A;  1S3X A;  1PX9 A;  1NRB A;  3QML A;  1NPI A;  3CW4 A;  1KAZ A;  1NGJ A;  3FE1 A;  1ZYV A;  5AQV A;  1NH5 A;  2QWM A;  3R2V A;  1FH3 A;  4AEI A; 
#chains in the Genus database with same CATH homology
 1UGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...