1UGLA

Solution structure of s8-sp11
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
50
structure length
50
Chain Sequence
NLMKRCTRGFRKLGKCTTLEEEKCKTLYPRGQCTCSDSKMNTHSCDCKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-locus pollen protein
publication title Structure of the Male Determinant Factor for Brassica Self-incompatibility
pubmed doi rcsb
molecule tags Plant protein
total genus 7
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2003-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.70 Alpha Beta 2-Layer Sandwich Defensin A-like Scorpion toxin-like 1uglA00
1UGLA
chains in the Genus database with same CATH superfamily
2QWPA 3LDQA 2QWOA 3BK3C 1NH5A 1N4NA 1OZZA 3FZMA 3GKUA 5AQZA 2QWLA 4AB0A 1T7EA 2A7TA 1P00A 2SN3A 3ATVA 1NE5A 1ATSA 4FL9A 4KBOA 1GPTA 2QWRA 5AQSA 1ICAA 3ATUA 2YIOA 5AQRA 2KGQA 3M3ZA 1L4VA 3KC6A 1T7AA 1QQMA 3KP0A 5FPDA 1NRBA 2KYQA 1QQNA 2QW9A 1SNBA 3E7RL 2LT8A 2YBRC 5AQLA 1B3CA 3D2FB 2LKBA 1I6FA 1NGBA 1B7DA 2E3FA 1JZAA 1NGIA 3FZHA 4CQKA 2KBHA 3KOXA 1SEGA 2LJ7A 3GL1A 1OMYA 3D2FA 4UADE 5FPEA 1KAZA 4H5RA 1NGGA 1SN4A 5BPLA 1LQHA 2E8AA 4AEIA 3SF4D 2LR3A 3L4IA 2YEOA 1S3XA 2K35A 5FPNA 2LJMA 5BN9A 2QWQA 1I6GA 1DQ7A 1FH3A 2LY5A 5AQWA 2JDQD 4HHFA 4UAEF 5AQIA 2KHOA 2NY8X 5EVZA 1BCGA 5AQOA 1BK8A 1C55A 1JXCA 2VY6A 5AQGA 5BPNA 1PE4A 5AQJA 2QWMA 1I2VA 3KHWA 1T1TA 1HX1A 5BN8A 3FZLA 1NGFA 4H5WA 3KOZA 2MN5A 3LDPA 4UAFE 4H5NA 1ZFUA 3E7UX 1WT7A 5AQYA 2B3CA 1T0ZA 1WMTA 1XRSB 1ZU3A 2B68A 3FE1A 1YUWA 4FSVA 5AQFA 1POIA 3HSCA 3FZKA 1GPSA 1CHZA 1VNBA 2V7ZA 5KK4A 1JKZA 1MR4A 2N69A 5F2RA 3QFPA 1SN1A 1JZBA 2KPYA 2ASCA 5AQUA 3LDNA 5EX5A 1I2UA 1NGJA 1BMRA 5AQMA 3R2VA 2N2RA 1NRAA 2E0HA 5AQKA 1T7BA 2YILA 2ATBA 1K8BA 3L6QA 1MYNA 3I33A 5FPMA 3KVGA 2N2QA 1BA1A 3KP1A 1HJOA 3FZFA 1ZVEA 1DJTA 3QI7A 3QMLA 1NGAA 1TI5A 1ATRA 2KSKA 3IUCA 1DKGD 2MBKA 4HE7A 1LQIA 3D2EB 5AQQA 5EXWA 5AR0A 2GMOA 2KBKA 2KJAA 2QWNA 5F0XA 2BRZA 1NGEA 2D56A 5AQPA 5AQHA 3AY9A 1BRZA 3JXUA 1NGCA 2MZ0A 1ZUTA 2E2FA 1AYJA 4V1DC 5F1XA 3D2EA 2LN8A 2LI7A 3KOWA 1BA0A 1P0AA 1WWNA 5AQXA 1ZYWA 5BPMA 3L56A 2I61A 1PX9A 3LDOA 3A8YA 1KAXA 3PSMA 2YC1C 1NGHA 1C56A 5AQVA 1ZVGA 2GL1A 3C7NB 5EY4A 2YIPA 1KV0A 3QFUA 4GNIA 4H5VA 1KAYA 2BUPA 5AQNA 3CW4A 4KYPA 4H5TA 1QQOA 2G2KA 4AAZA 2NY9X 1VNAA 3C7NA 1ZYVA 1LQQA 1AHOA 3CQXA 3GDQA 2QXLA 1BUPA 1PTXA 1NPIA 3LDLA 4IO8A 1NGDA 2N66A 4HWIA 2E3GA 3KOYA 5AQTA 1CN2A 2E88A 2LY6A 2M8BB 4UJ0A 1HPMA 1UGLA 5CY0A 2KBJA
chains in the Genus database with same CATH topology
1UGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGL A; 
#chains in the Genus database with same CATH topology
 2QWP A;  3LDQ A;  2QWO A;  3BK3 C;  1NH5 A;  1N4N A;  1OZZ A;  3FZM A;  3GKU A;  5AQZ A;  2QWL A;  4AB0 A;  1T7E A;  2A7T A;  1P00 A;  2SN3 A;  3ATV A;  1NE5 A;  1ATS A;  4FL9 A;  4KBO A;  1GPT A;  2QWR A;  5AQS A;  1ICA A;  3ATU A;  2YIO A;  5AQR A;  2KGQ A;  3M3Z A;  1L4V A;  3KC6 A;  1T7A A;  1QQM A;  3KP0 A;  5FPD A;  1NRB A;  2KYQ A;  1QQN A;  2QW9 A;  1SNB A;  3E7R L;  2LT8 A;  2YBR C;  5AQL A;  1B3C A;  3D2F B;  2LKB A;  1I6F A;  1NGB A;  1B7D A;  2E3F A;  1JZA A;  1NGI A;  3FZH A;  4CQK A;  2KBH A;  3KOX A;  1SEG A;  2LJ7 A;  3GL1 A;  1OMY A;  3D2F A;  4UAD E;  5FPE A;  1KAZ A;  4H5R A;  1NGG A;  1SN4 A;  5BPL A;  1LQH A;  2E8A A;  4AEI A;  3SF4 D;  2LR3 A;  3L4I A;  2YEO A;  1S3X A;  2K35 A;  5FPN A;  2LJM A;  5BN9 A;  2QWQ A;  1I6G A;  1DQ7 A;  1FH3 A;  2LY5 A;  5AQW A;  2JDQ D;  4HHF A;  4UAE F;  5AQI A;  2KHO A;  2NY8 X;  5EVZ A;  1BCG A;  5AQO A;  1BK8 A;  1C55 A;  1JXC A;  2VY6 A;  5AQG A;  5BPN A;  1PE4 A;  5AQJ A;  2QWM A;  1I2V A;  3KHW A;  1T1T A;  1HX1 A;  5BN8 A;  3FZL A;  1NGF A;  4H5W A;  3KOZ A;  2MN5 A;  3LDP A;  4UAF E;  4H5N A;  1ZFU A;  3E7U X;  1WT7 A;  5AQY A;  2B3C A;  1T0Z A;  1WMT A;  1XRS B;  1ZU3 A;  2B68 A;  3FE1 A;  1YUW A;  4FSV A;  5AQF A;  1POI A;  3HSC A;  3FZK A;  1GPS A;  1CHZ A;  1VNB A;  2V7Z A;  5KK4 A;  1JKZ A;  1MR4 A;  2N69 A;  5F2R A;  3QFP A;  1SN1 A;  1JZB A;  2KPY A;  2ASC A;  5AQU A;  3LDN A;  5EX5 A;  1I2U A;  1NGJ A;  1BMR A;  5AQM A;  3R2V A;  2N2R A;  1NRA A;  2E0H A;  5AQK A;  1T7B A;  2YIL A;  2ATB A;  1K8B A;  3L6Q A;  1MYN A;  3I33 A;  5FPM A;  3KVG A;  2N2Q A;  1BA1 A;  3KP1 A;  1HJO A;  3FZF A;  1ZVE A;  1DJT A;  3QI7 A;  3QML A;  1NGA A;  1TI5 A;  1ATR A;  2KSK A;  3IUC A;  1DKG D;  2MBK A;  4HE7 A;  1LQI A;  3D2E B;  5AQQ A;  5EXW A;  5AR0 A;  2GMO A;  2KBK A;  2KJA A;  2QWN A;  5F0X A;  2BRZ A;  1NGE A;  2D56 A;  5AQP A;  5AQH A;  3AY9 A;  1BRZ A;  3JXU A;  1NGC A;  2MZ0 A;  1ZUT A;  2E2F A;  1AYJ A;  4V1D C;  5F1X A;  3D2E A;  2LN8 A;  2LI7 A;  3KOW A;  1BA0 A;  1P0A A;  1WWN A;  5AQX A;  1ZYW A;  5BPM A;  3L56 A;  2I61 A;  1PX9 A;  3LDO A;  3A8Y A;  1KAX A;  3PSM A;  2YC1 C;  1NGH A;  1C56 A;  5AQV A;  1ZVG A;  2GL1 A;  3C7N B;  5EY4 A;  2YIP A;  1KV0 A;  3QFU A;  4GNI A;  4H5V A;  1KAY A;  2BUP A;  5AQN A;  3CW4 A;  4KYP A;  4H5T A;  1QQO A;  2G2K A;  4AAZ A;  2NY9 X;  1VNA A;  3C7N A;  1ZYV A;  1LQQ A;  1AHO A;  3CQX A;  3GDQ A;  2QXL A;  1BUP A;  1PTX A;  1NPI A;  3LDL A;  4IO8 A;  1NGD A;  2N66 A;  4HWI A;  2E3G A;  3KOY A;  5AQT A;  1CN2 A;  2E88 A;  2LY6 A;  2M8B B;  4UJ0 A;  1HPM A;  1UGL A;  5CY0 A;  2KBJ A; 
#chains in the Genus database with same CATH homology
 1UGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...