4HE7A

Crystal structure of brazzein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
54
structure length
54
Chain Sequence
EDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defensin-like protein
publication title The structure of brazzein, a sweet-tasting protein from the wild African plant Pentadiplandra brazzeana
pubmed doi rcsb
molecule tags Plant protein
total genus 13
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2012-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 4he7A00
1GPSA 1LQQA 1NRBA 1OZZA 1SEGA 2GL1A 1I2UA 1SN1A 1CN2A 2LJMA 3E7UX 1ZYWA 1KV0A 1NH5A 1T7AA 1ZU3A 2LY6A 2NY8X 1CHZA 1LQHA 4AB0A 1GPTA 2A7TA 1PX9A 1T0ZA 2E0HA 1P0AA 1ZYVA 1WMTA 2N2RA 1BCGA 4HE7A 1JZBA 2ASCA 1FH3A 2YBRC 2LJ7A 1WT7A 1PTXA 1NPIA 1T7BA 2N66A 1AHOA 1N4NA 1NRAA 1ZVEA 1I6FA 1TI5A 1JXCA 1MYNA 1WWNA 5KK4A 4UJ0A 1DQ7A 1VNAA 2KBJA 2KGQA 2NY9X 1LQIA 4AAZA 2E3FA 2M8BB 2YEOA 1BK8A 4KYPA 1JKZA 1PE4A 1DJTA 1SNBA 2YC1C 2LI7A 3PSMA 1B3CA 2KSKA 1T1TA 2KPYA 3E7RL 4AEIA 2LT8A 4V1DC 1C56A 2BRZA 1BMRA 1ZVGA 2KBHA 1BRZA 2SN3A 2KYQA 1L4VA 1AYJA 4CQKA 1B7DA 2N69A 1T7EA 2ATBA 1NE5A 1ZUTA 1C55A 1OMYA 2B3CA 1SN4A 1ICAA 2LY5A 2LKBA 2MZ0A 2B68A 2I61A 1VNBA 1MR4A 4HHFA 1ZFUA 2KBKA 1I2VA 2N2QA 5CY0A 1I6GA 2E3GA 2KJAA 1JZAA 2LR3A 1P00A
chains in the Genus database with same CATH superfamily
1GPSA 1LQQA 3AY9A 5AQIA 5AQKA 1NRBA 2QWLA 5AQQA 1S3XA 1OZZA 1SEGA 1DKGD 3KOYA 5EXWA 1HX1A 3L6QA 2GL1A 1NGGA 1SN1A 1XRSB 3KOWA 3L56A 5AQRA 1YUWA 2K35A 2LJMA 3E7UX 1ZYWA 1CN2A 1NGCA 3HSCA 4GNIA 1KV0A 1NH5A 1T7AA 1ZU3A 2LY6A 2NY8X 1CHZA 1LQHA 4AB0A 5BN8A 1GPTA 2BUPA 2A7TA 2KHOA 5F2RA 2QWRA 1PX9A 1QQOA 1KAXA 1T0ZA 1NGBA 5BPLA 5AQVA 3LDPA 3CW4A 3LDOA 1BA0A 3GL1A 5EY4A 2E0HA 2QWNA 3KP0A 3GKUA 2QWMA 3KP1A 5EVZA 5AQXA 5AQYA 1ZYVA 1WMTA 3JXUA 2N2RA 1BCGA 2VY6A 4HE7A 5AQZA 1NGJA 1JZBA 2ASCA 1KAZA 3A8YA 1FH3A 2YBRC 2LJ7A 1QQNA 1WT7A 1NGIA 1NGDA 3FE1A 3D2EB 3SF4D 1PTXA 1NPIA 1T7BA 2N66A 5FPNA 1AHOA 3LDQA 3FZHA 1N4NA 1BA1A 3M3ZA 1NRAA 4UAEF 1ZVEA 2E8AA 5F0XA 4H5TA 1I6FA 5AQJA 3C7NB 3FZMA 1TI5A 1JXCA 4UAFE 5BPMA 1MYNA 1WWNA 2QWPA 3D2FB 1HJOA 5KK4A 4UJ0A 1DQ7A 1VNAA 2KBJA 3KC6A 2KGQA 2NY9X 1LQIA 4AAZA 1NGFA 2E3FA 2M8BB 2MBKA 2YEOA 3I33A 3QMLA 4H5VA 4KYPA 1BK8A 4UADE 5AQPA 5AQNA 3ATUA 1JKZA 1PE4A 3L4IA 2LN8A 2YILA 1DJTA 2E88A 1SNBA 2YC1C 4HWIA 2LI7A 3PSMA 5BN9A 1B3CA 2KSKA 2QXLA 1NGAA 3FZKA 2GMOA 3ATVA 5F1XA 5FPEA 1T1TA 1UGLA 2YIPA 2KPYA 5AQOA 3KVGA 1ATRA 3KHWA 3LDLA 2QWQA 5AQHA 3E7RL 3CQXA 3FZFA 1NGEA 3QFUA 4AEIA 2LR3A 2LT8A 4FL9A 4V1DC 3GDQA 1C56A 2BRZA 1BMRA 1ZVGA 2KBHA 4FSVA 2E2FA 1BRZA 2SN3A 2KYQA 1I2UA 4H5RA 1AYJA 3FZLA 1L4VA 5AQSA 2QWOA 4CQKA 1B7DA 5FPDA 2N69A 1T7EA 2ATBA 3R2VA 5FPMA 4H5WA 3QFPA 1NE5A 1ZUTA 1QQMA 1POIA 1HPMA 2D56A 1C55A 5AQGA 1OMYA 2B3CA 3IUCA 1ATSA 3D2EA 2YIOA 5BPNA 3QI7A 5AQLA 5AQFA 1NGHA 2G2KA 3BK3C 1SN4A 2QW9A 1ICAA 2LY5A 2LKBA 2MZ0A 3KOZA 2B68A 1BUPA 2I61A 4H5NA 5AQTA 5AR0A 1VNBA 1MR4A 3C7NA 3LDNA 1ZFUA 4HHFA 2KBKA 5AQMA 2V7ZA 5AQWA 1I2VA 1K8BA 3D2FA 1KAYA 2N2QA 5CY0A 2JDQD 1I6GA 2E3GA 3KOXA 2KJAA 4IO8A 1JZAA 2MN5A 1P0AA 1P00A 4KBOA 5AQUA 5EX5A
chains in the Genus database with same CATH topology
1GPSA 1LQQA 1NRBA 1OZZA 1SEGA 2GL1A 1I2UA 1SN1A 1CN2A 2LJMA 3E7UX 1ZYWA 1KV0A 1NH5A 1T7AA 1ZU3A 2LY6A 2NY8X 1CHZA 1LQHA 4AB0A 1GPTA 2A7TA 1PX9A 1T0ZA 2E0HA 1P0AA 1ZYVA 1WMTA 2N2RA 1BCGA 4HE7A 1JZBA 2ASCA 1FH3A 2YBRC 2LJ7A 1WT7A 1PTXA 1NPIA 1T7BA 2N66A 1AHOA 1N4NA 1NRAA 1ZVEA 1I6FA 1TI5A 1JXCA 1MYNA 1WWNA 5KK4A 4UJ0A 1DQ7A 1VNAA 2KBJA 2KGQA 2NY9X 1LQIA 4AAZA 2E3FA 2M8BB 2YEOA 1BK8A 4KYPA 1JKZA 1PE4A 1DJTA 1SNBA 2YC1C 2LI7A 3PSMA 1B3CA 2KSKA 1T1TA 2KPYA 3E7RL 4AEIA 2LT8A 4V1DC 1C56A 2BRZA 1BMRA 1ZVGA 2KBHA 1BRZA 2SN3A 2KYQA 1L4VA 1AYJA 4CQKA 1B7DA 2N69A 1T7EA 2ATBA 1NE5A 1ZUTA 1C55A 1OMYA 2B3CA 1SN4A 1ICAA 2LY5A 2LKBA 2MZ0A 2B68A 2I61A 1VNBA 1MR4A 4HHFA 1ZFUA 2KBKA 1I2VA 2N2QA 5CY0A 1I6GA 2E3GA 2KJAA 1JZAA 2LR3A 1P00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GPS A;  1LQQ A;  1NRB A;  1OZZ A;  1SEG A;  2GL1 A;  1I2U A;  1SN1 A;  1CN2 A;  2LJM A;  3E7U X;  1ZYW A;  1KV0 A;  1NH5 A;  1T7A A;  1ZU3 A;  2LY6 A;  2NY8 X;  1CHZ A;  1LQH A;  4AB0 A;  1GPT A;  2A7T A;  1PX9 A;  1T0Z A;  2E0H A;  1P0A A;  1ZYV A;  1WMT A;  2N2R A;  1BCG A;  4HE7 A;  1JZB A;  2ASC A;  1FH3 A;  2YBR C;  2LJ7 A;  1WT7 A;  1PTX A;  1NPI A;  1T7B A;  2N66 A;  1AHO A;  1N4N A;  1NRA A;  1ZVE A;  1I6F A;  1TI5 A;  1JXC A;  1MYN A;  1WWN A;  5KK4 A;  4UJ0 A;  1DQ7 A;  1VNA A;  2KBJ A;  2KGQ A;  2NY9 X;  1LQI A;  4AAZ A;  2E3F A;  2M8B B;  2YEO A;  1BK8 A;  4KYP A;  1JKZ A;  1PE4 A;  1DJT A;  1SNB A;  2YC1 C;  2LI7 A;  3PSM A;  1B3C A;  2KSK A;  1T1T A;  2KPY A;  3E7R L;  4AEI A;  2LT8 A;  4V1D C;  1C56 A;  2BRZ A;  1BMR A;  1ZVG A;  2KBH A;  1BRZ A;  2SN3 A;  2KYQ A;  1L4V A;  1AYJ A;  4CQK A;  1B7D A;  2N69 A;  1T7E A;  2ATB A;  1NE5 A;  1ZUT A;  1C55 A;  1OMY A;  2B3C A;  1SN4 A;  1ICA A;  2LY5 A;  2LKB A;  2MZ0 A;  2B68 A;  2I61 A;  1VNB A;  1MR4 A;  4HHF A;  1ZFU A;  2KBK A;  1I2V A;  2N2Q A;  5CY0 A;  1I6G A;  2E3G A;  2KJA A;  1JZA A;  2LR3 A;  1P00 A; 
#chains in the Genus database with same CATH topology
 1GPS A;  1LQQ A;  3AY9 A;  5AQI A;  5AQK A;  1NRB A;  2QWL A;  5AQQ A;  1S3X A;  1OZZ A;  1SEG A;  1DKG D;  3KOY A;  5EXW A;  1HX1 A;  3L6Q A;  2GL1 A;  1NGG A;  1SN1 A;  1XRS B;  3KOW A;  3L56 A;  5AQR A;  1YUW A;  2K35 A;  2LJM A;  3E7U X;  1ZYW A;  1CN2 A;  1NGC A;  3HSC A;  4GNI A;  1KV0 A;  1NH5 A;  1T7A A;  1ZU3 A;  2LY6 A;  2NY8 X;  1CHZ A;  1LQH A;  4AB0 A;  5BN8 A;  1GPT A;  2BUP A;  2A7T A;  2KHO A;  5F2R A;  2QWR A;  1PX9 A;  1QQO A;  1KAX A;  1T0Z A;  1NGB A;  5BPL A;  5AQV A;  3LDP A;  3CW4 A;  3LDO A;  1BA0 A;  3GL1 A;  5EY4 A;  2E0H A;  2QWN A;  3KP0 A;  3GKU A;  2QWM A;  3KP1 A;  5EVZ A;  5AQX A;  5AQY A;  1ZYV A;  1WMT A;  3JXU A;  2N2R A;  1BCG A;  2VY6 A;  4HE7 A;  5AQZ A;  1NGJ A;  1JZB A;  2ASC A;  1KAZ A;  3A8Y A;  1FH3 A;  2YBR C;  2LJ7 A;  1QQN A;  1WT7 A;  1NGI A;  1NGD A;  3FE1 A;  3D2E B;  3SF4 D;  1PTX A;  1NPI A;  1T7B A;  2N66 A;  5FPN A;  1AHO A;  3LDQ A;  3FZH A;  1N4N A;  1BA1 A;  3M3Z A;  1NRA A;  4UAE F;  1ZVE A;  2E8A A;  5F0X A;  4H5T A;  1I6F A;  5AQJ A;  3C7N B;  3FZM A;  1TI5 A;  1JXC A;  4UAF E;  5BPM A;  1MYN A;  1WWN A;  2QWP A;  3D2F B;  1HJO A;  5KK4 A;  4UJ0 A;  1DQ7 A;  1VNA A;  2KBJ A;  3KC6 A;  2KGQ A;  2NY9 X;  1LQI A;  4AAZ A;  1NGF A;  2E3F A;  2M8B B;  2MBK A;  2YEO A;  3I33 A;  3QML A;  4H5V A;  4KYP A;  1BK8 A;  4UAD E;  5AQP A;  5AQN A;  3ATU A;  1JKZ A;  1PE4 A;  3L4I A;  2LN8 A;  2YIL A;  1DJT A;  2E88 A;  1SNB A;  2YC1 C;  4HWI A;  2LI7 A;  3PSM A;  5BN9 A;  1B3C A;  2KSK A;  2QXL A;  1NGA A;  3FZK A;  2GMO A;  3ATV A;  5F1X A;  5FPE A;  1T1T A;  1UGL A;  2YIP A;  2KPY A;  5AQO A;  3KVG A;  1ATR A;  3KHW A;  3LDL A;  2QWQ A;  5AQH A;  3E7R L;  3CQX A;  3FZF A;  1NGE A;  3QFU A;  4AEI A;  2LR3 A;  2LT8 A;  4FL9 A;  4V1D C;  3GDQ A;  1C56 A;  2BRZ A;  1BMR A;  1ZVG A;  2KBH A;  4FSV A;  2E2F A;  1BRZ A;  2SN3 A;  2KYQ A;  1I2U A;  4H5R A;  1AYJ A;  3FZL A;  1L4V A;  5AQS A;  2QWO A;  4CQK A;  1B7D A;  5FPD A;  2N69 A;  1T7E A;  2ATB A;  3R2V A;  5FPM A;  4H5W A;  3QFP A;  1NE5 A;  1ZUT A;  1QQM A;  1POI A;  1HPM A;  2D56 A;  1C55 A;  5AQG A;  1OMY A;  2B3C A;  3IUC A;  1ATS A;  3D2E A;  2YIO A;  5BPN A;  3QI7 A;  5AQL A;  5AQF A;  1NGH A;  2G2K A;  3BK3 C;  1SN4 A;  2QW9 A;  1ICA A;  2LY5 A;  2LKB A;  2MZ0 A;  3KOZ A;  2B68 A;  1BUP A;  2I61 A;  4H5N A;  5AQT A;  5AR0 A;  1VNB A;  1MR4 A;  3C7N A;  3LDN A;  1ZFU A;  4HHF A;  2KBK A;  5AQM A;  2V7Z A;  5AQW A;  1I2V A;  1K8B A;  3D2F A;  1KAY A;  2N2Q A;  5CY0 A;  2JDQ D;  1I6G A;  2E3G A;  3KOX A;  2KJA A;  4IO8 A;  1JZA A;  2MN5 A;  1P0A A;  1P00 A;  4KBO A;  5AQU A;  5EX5 A; 
#chains in the Genus database with same CATH homology
 1GPS A;  1LQQ A;  1NRB A;  1OZZ A;  1SEG A;  2GL1 A;  1I2U A;  1SN1 A;  1CN2 A;  2LJM A;  3E7U X;  1ZYW A;  1KV0 A;  1NH5 A;  1T7A A;  1ZU3 A;  2LY6 A;  2NY8 X;  1CHZ A;  1LQH A;  4AB0 A;  1GPT A;  2A7T A;  1PX9 A;  1T0Z A;  2E0H A;  1P0A A;  1ZYV A;  1WMT A;  2N2R A;  1BCG A;  4HE7 A;  1JZB A;  2ASC A;  1FH3 A;  2YBR C;  2LJ7 A;  1WT7 A;  1PTX A;  1NPI A;  1T7B A;  2N66 A;  1AHO A;  1N4N A;  1NRA A;  1ZVE A;  1I6F A;  1TI5 A;  1JXC A;  1MYN A;  1WWN A;  5KK4 A;  4UJ0 A;  1DQ7 A;  1VNA A;  2KBJ A;  2KGQ A;  2NY9 X;  1LQI A;  4AAZ A;  2E3F A;  2M8B B;  2YEO A;  1BK8 A;  4KYP A;  1JKZ A;  1PE4 A;  1DJT A;  1SNB A;  2YC1 C;  2LI7 A;  3PSM A;  1B3C A;  2KSK A;  1T1T A;  2KPY A;  3E7R L;  4AEI A;  2LT8 A;  4V1D C;  1C56 A;  2BRZ A;  1BMR A;  1ZVG A;  2KBH A;  1BRZ A;  2SN3 A;  2KYQ A;  1L4V A;  1AYJ A;  4CQK A;  1B7D A;  2N69 A;  1T7E A;  2ATB A;  1NE5 A;  1ZUT A;  1C55 A;  1OMY A;  2B3C A;  1SN4 A;  1ICA A;  2LY5 A;  2LKB A;  2MZ0 A;  2B68 A;  2I61 A;  1VNB A;  1MR4 A;  4HHF A;  1ZFU A;  2KBK A;  1I2V A;  2N2Q A;  5CY0 A;  1I6G A;  2E3G A;  2KJA A;  1JZA A;  2LR3 A;  1P00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...