4HE7A

Crystal structure of brazzein
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
54
structure length
54
Chain Sequence
b'EDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defensin-like protein
publication title The structure of brazzein, a sweet-tasting protein from the wild African plant Pentadiplandra brazzeana
pubmed doi rcsb
molecule tags Plant protein
total genus 13
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2012-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 4he7A00
1I6GA 1ZVGA 1GPTA 5CY0A 4AEIA 1VNAA 2LI7A 1C56A 2KBJA 3E7RL 1C55A 1AYJA 2LY5A 2KYQA 5KK4A 1NPIA 1ZFUA 1T0ZA 2LJ7A 1L4VA 1LQHA 4HHFA 2KSKA 1ZYWA 1SN4A 2MZ0A 1BRZA 1WMTA 2M8BB 1GPSA 1PX9A 1B7DA 1OZZA 1AHOA 2N66A 2N2QA 1T7EA 2LR3A 2LKBA 2N2RA 3PSMA 1JZBA 1SNBA 1VNBA 1BMRA 2LT8A 4KYPA 4AAZA 1PE4A 1KV0A 2KBKA 2NY8X 1ZU3A 1T7AA 1P0AA 1SEGA 2B68A 1DJTA 2LY6A 1NRAA 1WWNA 2YBRC 2NY9X 1JZAA 1ICAA 2YC1C 1B3CA 1I2UA 1JXCA 2ASCA 2KBHA 1I2VA 1BK8A 2N69A 1T1TA 2GL1A 2E3FA 2E3GA 2YEOA 1MR4A 1ZVEA 2I61A 2SN3A 1FH3A 1ZYVA 2BRZA 4V1DC 1CN2A 1LQQA 1JKZA 1WT7A 1CHZA 2ATBA 1N4NA 1ZUTA 3E7UX 1NRBA 1OMYA 2E0HA 2LJMA 1T7BA 1PTXA 1I6FA 1P00A 4HE7A 1MYNA 2KJAA 4AB0A 1TI5A 2B3CA 2KGQA 1NH5A 1DQ7A 4UJ0A 2A7TA 1LQIA 4CQKA 1SN1A 1NE5A 2KPYA 1BCGA
chains in the Genus database with same CATH superfamily
1I6GA 1ZVGA 4IO8A 1GPTA 2BUPA 5CY0A 3JXUA 4AEIA 1VNAA 2LI7A 1C56A 2KBJA 3LDOA 4HWIA 3KOYA 5FPEA 3E7RL 5EX5A 1C55A 2G2KA 2LY5A 1AYJA 2KYQA 3KP0A 5EXWA 2V7ZA 5KK4A 1QQNA 3D2EB 2E88A 3KC6A 4H5WA 5AQLA 1NPIA 1BUPA 1NGHA 1NGAA 3FZMA 4UADE 2QWPA 1ZFUA 1YUWA 3FZFA 1T0ZA 1NGCA 4H5RA 2LN8A 3AY9A 5AQXA 2LJ7A 1UGLA 3L6QA 1L4VA 1LQHA 4HHFA 2KSKA 5AQTA 1BA0A 1NGDA 1SN4A 1ZYWA 1WMTA 2MZ0A 1BRZA 2M8BB 1GPSA 5F2RA 5AQPA 1PX9A 1B7DA 1OZZA 1AHOA 3I33A 2N66A 2N2QA 5AQVA 4UAFE 5BN8A 1T7EA 2LR3A 2LKBA 2JDQD 2N2RA 2VY6A 3FZLA 1JZBA 1SNBA 3PSMA 3D2EA 1HX1A 2KHOA 5AQKA 5AQQA 1VNBA 2KPYA 3GKUA 1NGBA 2D56A 5FPNA 1DKGD 1BMRA 1NGFA 2LT8A 5AR0A 2MN5A 4KYPA 4H5TA 4AAZA 1PE4A 3LDNA 1KV0A 2YILA 5AQOA 4GNIA 5AQIA 3R2VA 3A8YA 2KBKA 2NY8X 1ZU3A 3L4IA 1T7AA 3LDLA 1XRSB 3KP1A 2YIPA 1P0AA 5AQFA 1HJOA 4KBOA 3KHWA 3KOWA 5EY4A 5F0XA 3KVGA 1K8BA 4FSVA 3QMLA 5AQZA 3QFUA 1SEGA 2B68A 1DJTA 3HSCA 1I2VA 2LY6A 1NRAA 1WWNA 2GMOA 3SF4D 2YBRC 2NY9X 1JZAA 3L56A 1ICAA 2YC1C 1B3CA 3C7NB 5BPMA 3D2FB 1I2UA 1JXCA 2ASCA 2KBHA 1NGIA 1NGJA 1BK8A 4H5VA 3FZHA 2N69A 4UAEF 1ATRA 5AQSA 1T1TA 5BN9A 5F1XA 2QXLA 2GL1A 1QQOA 2E3FA 4FL9A 5AQHA 5AQRA 3IUCA 5FPMA 2E3GA 2YEOA 3GL1A 5FPDA 1MR4A 1POIA 2YIOA 1S3XA 1ZVEA 1BA1A 2E2FA 2I61A 2SN3A 5AQJA 1FH3A 1ZYVA 2BRZA 4H5NA 3GDQA 1LQQA 4V1DC 1CN2A 1JKZA 3QFPA 1CHZA 3CW4A 3CQXA 5AQGA 2K35A 2ATBA 3C7NA 1QQMA 3D2FA 5AQWA 1N4NA 2QWNA 1ATSA 3ATVA 1ZUTA 1KAXA 3E7UX 2QW9A 5AQNA 2QWRA 3ATUA 3FZKA 3KOXA 1NRBA 1OMYA 2E0HA 2MBKA 1KAZA 3LDPA 2LJMA 3M3ZA 1T7BA 5EVZA 5BPNA 5AQMA 5AQYA 1NGEA 5BPLA 3LDQA 1PTXA 2QWLA 5AQUA 1I6FA 1P00A 4HE7A 1KAYA 1MYNA 2KJAA 4AB0A 3QI7A 1NGGA 1TI5A 1DQ7A 1NH5A 2B3CA 2E8AA 2KGQA 2QWOA 2QWQA 2QWMA 2A7TA 3BK3C 4UJ0A 1HPMA 1LQIA 4CQKA 1SN1A 3KOZA 3FE1A 1NE5A 1WT7A 1BCGA
chains in the Genus database with same CATH topology
1I6GA 1ZVGA 1GPTA 5CY0A 4AEIA 1VNAA 2LI7A 1C56A 2KBJA 3E7RL 1C55A 1AYJA 2LY5A 2KYQA 5KK4A 1NPIA 1ZFUA 1T0ZA 2LJ7A 1L4VA 1LQHA 4HHFA 2KSKA 1ZYWA 1SN4A 2MZ0A 1BRZA 1WMTA 2M8BB 1GPSA 1PX9A 1B7DA 1OZZA 1AHOA 2N66A 2N2QA 1T7EA 2LR3A 2LKBA 2N2RA 3PSMA 1JZBA 1SNBA 1VNBA 1BMRA 2LT8A 4KYPA 4AAZA 1PE4A 1KV0A 2KBKA 2NY8X 1ZU3A 1T7AA 1P0AA 1SEGA 2B68A 1DJTA 2LY6A 1NRAA 1WWNA 2YBRC 2NY9X 1JZAA 1ICAA 2YC1C 1B3CA 1I2UA 1JXCA 2ASCA 2KBHA 1I2VA 1BK8A 2N69A 1T1TA 2GL1A 2E3FA 2E3GA 2YEOA 1MR4A 1ZVEA 2I61A 2SN3A 1FH3A 1ZYVA 2BRZA 4V1DC 1CN2A 1LQQA 1JKZA 1WT7A 1CHZA 2ATBA 1N4NA 1ZUTA 3E7UX 1NRBA 1OMYA 2E0HA 2LJMA 1T7BA 1PTXA 1I6FA 1P00A 4HE7A 1MYNA 2KJAA 4AB0A 1TI5A 2B3CA 2KGQA 1NH5A 1DQ7A 4UJ0A 2A7TA 1LQIA 4CQKA 1SN1A 1NE5A 2KPYA 1BCGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6G A;  1ZVG A;  1GPT A;  5CY0 A;  4AEI A;  1VNA A;  2LI7 A;  1C56 A;  2KBJ A;  3E7R L;  1C55 A;  1AYJ A;  2LY5 A;  2KYQ A;  5KK4 A;  1NPI A;  1ZFU A;  1T0Z A;  2LJ7 A;  1L4V A;  1LQH A;  4HHF A;  2KSK A;  1ZYW A;  1SN4 A;  2MZ0 A;  1BRZ A;  1WMT A;  2M8B B;  1GPS A;  1PX9 A;  1B7D A;  1OZZ A;  1AHO A;  2N66 A;  2N2Q A;  1T7E A;  2LR3 A;  2LKB A;  2N2R A;  3PSM A;  1JZB A;  1SNB A;  1VNB A;  1BMR A;  2LT8 A;  4KYP A;  4AAZ A;  1PE4 A;  1KV0 A;  2KBK A;  2NY8 X;  1ZU3 A;  1T7A A;  1P0A A;  1SEG A;  2B68 A;  1DJT A;  2LY6 A;  1NRA A;  1WWN A;  2YBR C;  2NY9 X;  1JZA A;  1ICA A;  2YC1 C;  1B3C A;  1I2U A;  1JXC A;  2ASC A;  2KBH A;  1I2V A;  1BK8 A;  2N69 A;  1T1T A;  2GL1 A;  2E3F A;  2E3G A;  2YEO A;  1MR4 A;  1ZVE A;  2I61 A;  2SN3 A;  1FH3 A;  1ZYV A;  2BRZ A;  4V1D C;  1CN2 A;  1LQQ A;  1JKZ A;  1WT7 A;  1CHZ A;  2ATB A;  1N4N A;  1ZUT A;  3E7U X;  1NRB A;  1OMY A;  2E0H A;  2LJM A;  1T7B A;  1PTX A;  1I6F A;  1P00 A;  4HE7 A;  1MYN A;  2KJA A;  4AB0 A;  1TI5 A;  2B3C A;  2KGQ A;  1NH5 A;  1DQ7 A;  4UJ0 A;  2A7T A;  1LQI A;  4CQK A;  1SN1 A;  1NE5 A;  2KPY A;  1BCG A; 
#chains in the Genus database with same CATH topology
 1I6G A;  1ZVG A;  4IO8 A;  1GPT A;  2BUP A;  5CY0 A;  3JXU A;  4AEI A;  1VNA A;  2LI7 A;  1C56 A;  2KBJ A;  3LDO A;  4HWI A;  3KOY A;  5FPE A;  3E7R L;  5EX5 A;  1C55 A;  2G2K A;  2LY5 A;  1AYJ A;  2KYQ A;  3KP0 A;  5EXW A;  2V7Z A;  5KK4 A;  1QQN A;  3D2E B;  2E88 A;  3KC6 A;  4H5W A;  5AQL A;  1NPI A;  1BUP A;  1NGH A;  1NGA A;  3FZM A;  4UAD E;  2QWP A;  1ZFU A;  1YUW A;  3FZF A;  1T0Z A;  1NGC A;  4H5R A;  2LN8 A;  3AY9 A;  5AQX A;  2LJ7 A;  1UGL A;  3L6Q A;  1L4V A;  1LQH A;  4HHF A;  2KSK A;  5AQT A;  1BA0 A;  1NGD A;  1SN4 A;  1ZYW A;  1WMT A;  2MZ0 A;  1BRZ A;  2M8B B;  1GPS A;  5F2R A;  5AQP A;  1PX9 A;  1B7D A;  1OZZ A;  1AHO A;  3I33 A;  2N66 A;  2N2Q A;  5AQV A;  4UAF E;  5BN8 A;  1T7E A;  2LR3 A;  2LKB A;  2JDQ D;  2N2R A;  2VY6 A;  3FZL A;  1JZB A;  1SNB A;  3PSM A;  3D2E A;  1HX1 A;  2KHO A;  5AQK A;  5AQQ A;  1VNB A;  2KPY A;  3GKU A;  1NGB A;  2D56 A;  5FPN A;  1DKG D;  1BMR A;  1NGF A;  2LT8 A;  5AR0 A;  2MN5 A;  4KYP A;  4H5T A;  4AAZ A;  1PE4 A;  3LDN A;  1KV0 A;  2YIL A;  5AQO A;  4GNI A;  5AQI A;  3R2V A;  3A8Y A;  2KBK A;  2NY8 X;  1ZU3 A;  3L4I A;  1T7A A;  3LDL A;  1XRS B;  3KP1 A;  2YIP A;  1P0A A;  5AQF A;  1HJO A;  4KBO A;  3KHW A;  3KOW A;  5EY4 A;  5F0X A;  3KVG A;  1K8B A;  4FSV A;  3QML A;  5AQZ A;  3QFU A;  1SEG A;  2B68 A;  1DJT A;  3HSC A;  1I2V A;  2LY6 A;  1NRA A;  1WWN A;  2GMO A;  3SF4 D;  2YBR C;  2NY9 X;  1JZA A;  3L56 A;  1ICA A;  2YC1 C;  1B3C A;  3C7N B;  5BPM A;  3D2F B;  1I2U A;  1JXC A;  2ASC A;  2KBH A;  1NGI A;  1NGJ A;  1BK8 A;  4H5V A;  3FZH A;  2N69 A;  4UAE F;  1ATR A;  5AQS A;  1T1T A;  5BN9 A;  5F1X A;  2QXL A;  2GL1 A;  1QQO A;  2E3F A;  4FL9 A;  5AQH A;  5AQR A;  3IUC A;  5FPM A;  2E3G A;  2YEO A;  3GL1 A;  5FPD A;  1MR4 A;  1POI A;  2YIO A;  1S3X A;  1ZVE A;  1BA1 A;  2E2F A;  2I61 A;  2SN3 A;  5AQJ A;  1FH3 A;  1ZYV A;  2BRZ A;  4H5N A;  3GDQ A;  1LQQ A;  4V1D C;  1CN2 A;  1JKZ A;  3QFP A;  1CHZ A;  3CW4 A;  3CQX A;  5AQG A;  2K35 A;  2ATB A;  3C7N A;  1QQM A;  3D2F A;  5AQW A;  1N4N A;  2QWN A;  1ATS A;  3ATV A;  1ZUT A;  1KAX A;  3E7U X;  2QW9 A;  5AQN A;  2QWR A;  3ATU A;  3FZK A;  3KOX A;  1NRB A;  1OMY A;  2E0H A;  2MBK A;  1KAZ A;  3LDP A;  2LJM A;  3M3Z A;  1T7B A;  5EVZ A;  5BPN A;  5AQM A;  5AQY A;  1NGE A;  5BPL A;  3LDQ A;  1PTX A;  2QWL A;  5AQU A;  1I6F A;  1P00 A;  4HE7 A;  1KAY A;  1MYN A;  2KJA A;  4AB0 A;  3QI7 A;  1NGG A;  1TI5 A;  1DQ7 A;  1NH5 A;  2B3C A;  2E8A A;  2KGQ A;  2QWO A;  2QWQ A;  2QWM A;  2A7T A;  3BK3 C;  4UJ0 A;  1HPM A;  1LQI A;  4CQK A;  1SN1 A;  3KOZ A;  3FE1 A;  1NE5 A;  1WT7 A;  1BCG A; 
#chains in the Genus database with same CATH homology
 1I6G A;  1ZVG A;  1GPT A;  5CY0 A;  4AEI A;  1VNA A;  2LI7 A;  1C56 A;  2KBJ A;  3E7R L;  1C55 A;  1AYJ A;  2LY5 A;  2KYQ A;  5KK4 A;  1NPI A;  1ZFU A;  1T0Z A;  2LJ7 A;  1L4V A;  1LQH A;  4HHF A;  2KSK A;  1ZYW A;  1SN4 A;  2MZ0 A;  1BRZ A;  1WMT A;  2M8B B;  1GPS A;  1PX9 A;  1B7D A;  1OZZ A;  1AHO A;  2N66 A;  2N2Q A;  1T7E A;  2LR3 A;  2LKB A;  2N2R A;  3PSM A;  1JZB A;  1SNB A;  1VNB A;  1BMR A;  2LT8 A;  4KYP A;  4AAZ A;  1PE4 A;  1KV0 A;  2KBK A;  2NY8 X;  1ZU3 A;  1T7A A;  1P0A A;  1SEG A;  2B68 A;  1DJT A;  2LY6 A;  1NRA A;  1WWN A;  2YBR C;  2NY9 X;  1JZA A;  1ICA A;  2YC1 C;  1B3C A;  1I2U A;  1JXC A;  2ASC A;  2KBH A;  1I2V A;  1BK8 A;  2N69 A;  1T1T A;  2GL1 A;  2E3F A;  2E3G A;  2YEO A;  1MR4 A;  1ZVE A;  2I61 A;  2SN3 A;  1FH3 A;  1ZYV A;  2BRZ A;  4V1D C;  1CN2 A;  1LQQ A;  1JKZ A;  1WT7 A;  1CHZ A;  2ATB A;  1N4N A;  1ZUT A;  3E7U X;  1NRB A;  1OMY A;  2E0H A;  2LJM A;  1T7B A;  1PTX A;  1I6F A;  1P00 A;  4HE7 A;  1MYN A;  2KJA A;  4AB0 A;  1TI5 A;  2B3C A;  2KGQ A;  1NH5 A;  1DQ7 A;  4UJ0 A;  2A7T A;  1LQI A;  4CQK A;  1SN1 A;  1NE5 A;  2KPY A;  1BCG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...