2KBHA

Solution structure of bmkalphatx11 (major conformation)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
66
structure length
66
Chain Sequence
VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCYKLPDDARIMKPGRCNGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxin Bmka2
publication title Solution structure of BmKalphaTx11, a toxin from the venom of the Chinese scorpion Buthus martensii Karsch
pubmed doi rcsb
molecule tags Toxin
total genus 10
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2kbhA00
4UJ0A 1ZUTA 2N2RA 2KSKA 1I2VA 2MZ0A 2N69A 1DQ7A 1C56A 1GPTA 1I6GA 1GPSA 2KPYA 2YC1C 1ICAA 1CN2A 2KBKA 4AAZA 1VNAA 1NE5A 1OMYA 2B3CA 2NY8X 1FH3A 1DJTA 1SN4A 2LI7A 1I2UA 2E3FA 1LQIA 1SN1A 2NY9X 1TI5A 1WMTA 1SEGA 1B3CA 2KBJA 1KV0A 2ASCA 2YBRC 3E7RL 1WT7A 2YEOA 2KYQA 1VNBA 1B7DA 1JKZA 2LY5A 1JZAA 1JZBA 4AB0A 1AYJA 1NH5A 1ZFUA 2BRZA 1BMRA 2LJ7A 1ZYWA 2LR3A 1AHOA 1BRZA 2KBHA 2M8BB 2E3GA 4HE7A 2LT8A 2GL1A 2I61A 1T7BA 1ZVEA 2LY6A 3E7UX 1NPIA 1T0ZA 1T1TA 5KK4A 1MR4A 1ZU3A 4CQKA 2A7TA 1PE4A 1T7AA 1BCGA 1NRBA 2N66A 4KYPA 2KJAA 2SN3A 4V1DC 1JXCA 4AEIA 1N4NA 1PX9A 2B68A 1LQHA 1LQQA 1PTXA 1BK8A 1ZYVA 1OZZA 1NRAA 2LKBA 1ZVGA 1CHZA 2E0HA 2LJMA 1T7EA 3PSMA 1P0AA 1P00A 1WWNA 2ATBA 1SNBA 4HHFA 2N2QA 1C55A 2KGQA 1I6FA 1L4VA 1MYNA 5CY0A
chains in the Genus database with same CATH superfamily
5AQKA 3I33A 4H5NA 5EXWA 4UJ0A 5EX5A 2G2KA 2E8AA 1ZUTA 1NGCA 2KSKA 2N2RA 3C7NB 2MZ0A 3L4IA 1KAYA 2N69A 4H5VA 5FPDA 1DQ7A 4GNIA 5AQHA 1C56A 5F0XA 1GPTA 1I6GA 1GPSA 3A8YA 5AQUA 2KPYA 2YC1C 3CQXA 1ICAA 5BPNA 5AR0A 1CN2A 2KBKA 5AQMA 4AAZA 5AQLA 5BPMA 1VNAA 1NE5A 1OMYA 4HWIA 3AY9A 1BA1A 1S3XA 2B3CA 2NY8X 2QWPA 3FZLA 3KVGA 5F2RA 1DKGD 2E2FA 1DJTA 1SN4A 1FH3A 2LI7A 1I2UA 2E3FA 1LQIA 1SN1A 2VY6A 2NY9X 1TI5A 1WMTA 1K8BA 1SEGA 1YUWA 3L56A 4FL9A 1KAZA 3FE1A 3HSCA 1B3CA 2QWLA 3D2EB 2KBJA 1KV0A 2ASCA 2QWOA 3ATVA 3KHWA 2YBRC 5AQRA 2E88A 4UAEF 3E7RL 3D2FB 1WT7A 5EY4A 3LDPA 3BK3C 2YEOA 3KP0A 1HJOA 5AQXA 2BUPA 3QFUA 1NGGA 1VNBA 2KYQA 1B7DA 3R2VA 1JKZA 2JDQD 3GL1A 3M3ZA 5AQNA 2LY5A 1HPMA 1JZAA 1NGJA 1KAXA 1JZBA 3FZMA 5FPMA 4AB0A 1AYJA 3FZHA 1NH5A 1NGBA 1ZFUA 2BRZA 1BUPA 2QW9A 3LDOA 1XRSB 4H5WA 5AQIA 2LJ7A 3LDLA 1ZYWA 2LR3A 1BA0A 1AHOA 2KBHA 2M8BB 2MBKA 2YILA 2E3GA 2V7ZA 3CW4A 4H5TA 4HE7A 5EVZA 2LT8A 2GL1A 2I61A 1BRZA 1I2VA 1QQNA 1T7BA 1ZVEA 2LY6A 1QQMA 4FSVA 1ATRA 3E7UX 1NPIA 3LDQA 1HX1A 3D2EA 1NGHA 1T0ZA 1T1TA 1MR4A 2KHOA 5KK4A 3JXUA 3KOXA 1ZU3A 5AQVA 2A7TA 4CQKA 3C7NA 1PE4A 2MN5A 1T7AA 3D2FA 5AQJA 1BCGA 1NRBA 5AQYA 5F1XA 1UGLA 2GMOA 3FZKA 2N66A 2D56A 4KYPA 1POIA 1NGDA 2KJAA 2SN3A 1ATSA 2QWMA 3GDQA 4V1DC 5FPEA 1JXCA 3FZFA 3IUCA 3L6QA 4AEIA 1BMRA 1NGIA 1N4NA 1PX9A 2B68A 2YIOA 3KOZA 5BN9A 1LQHA 5AQPA 3QI7A 1LQQA 1PTXA 1BK8A 1ZYVA 1OZZA 4UADE 5AQWA 1NRAA 2QWQA 2K35A 5BPLA 1NGAA 3LDNA 2LKBA 3GKUA 3QMLA 1ZVGA 4UAFE 3KOWA 1CHZA 1NGFA 3KOYA 2E0HA 5AQFA 2LJMA 5FPNA 1T7EA 2QXLA 2QWNA 3ATUA 3PSMA 1P0AA 5AQTA 1P00A 4KBOA 1WWNA 3KC6A 1NGEA 3KP1A 2YIPA 5AQSA 5BN8A 2ATBA 4H5RA 4IO8A 1SNBA 1QQOA 3QFPA 3SF4D 2QWRA 4HHFA 5AQOA 5AQGA 2N2QA 1C55A 2KGQA 1I6FA 1L4VA 2LN8A 5AQZA 5AQQA 1MYNA 5CY0A
chains in the Genus database with same CATH topology
4UJ0A 1ZUTA 2N2RA 2KSKA 1I2VA 2MZ0A 2N69A 1DQ7A 1C56A 1GPTA 1I6GA 1GPSA 2KPYA 2YC1C 1ICAA 1CN2A 2KBKA 4AAZA 1VNAA 1NE5A 1OMYA 2B3CA 2NY8X 1FH3A 1DJTA 1SN4A 2LI7A 1I2UA 2E3FA 1LQIA 1SN1A 2NY9X 1TI5A 1WMTA 1SEGA 1B3CA 2KBJA 1KV0A 2ASCA 2YBRC 3E7RL 1WT7A 2YEOA 2KYQA 1VNBA 1B7DA 1JKZA 2LY5A 1JZAA 1JZBA 4AB0A 1AYJA 1NH5A 1ZFUA 2BRZA 1BMRA 2LJ7A 1ZYWA 2LR3A 1AHOA 1BRZA 2KBHA 2M8BB 2E3GA 4HE7A 2LT8A 2GL1A 2I61A 1T7BA 1ZVEA 2LY6A 3E7UX 1NPIA 1T0ZA 1T1TA 5KK4A 1MR4A 1ZU3A 4CQKA 2A7TA 1PE4A 1T7AA 1BCGA 1NRBA 2N66A 4KYPA 2KJAA 2SN3A 4V1DC 1JXCA 4AEIA 1N4NA 1PX9A 2B68A 1LQHA 1LQQA 1PTXA 1BK8A 1ZYVA 1OZZA 1NRAA 2LKBA 1ZVGA 1CHZA 2E0HA 2LJMA 1T7EA 3PSMA 1P0AA 1P00A 1WWNA 2ATBA 1SNBA 4HHFA 2N2QA 1C55A 2KGQA 1I6FA 1L4VA 1MYNA 5CY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UJ0 A;  1ZUT A;  2N2R A;  2KSK A;  1I2V A;  2MZ0 A;  2N69 A;  1DQ7 A;  1C56 A;  1GPT A;  1I6G A;  1GPS A;  2KPY A;  2YC1 C;  1ICA A;  1CN2 A;  2KBK A;  4AAZ A;  1VNA A;  1NE5 A;  1OMY A;  2B3C A;  2NY8 X;  1FH3 A;  1DJT A;  1SN4 A;  2LI7 A;  1I2U A;  2E3F A;  1LQI A;  1SN1 A;  2NY9 X;  1TI5 A;  1WMT A;  1SEG A;  1B3C A;  2KBJ A;  1KV0 A;  2ASC A;  2YBR C;  3E7R L;  1WT7 A;  2YEO A;  2KYQ A;  1VNB A;  1B7D A;  1JKZ A;  2LY5 A;  1JZA A;  1JZB A;  4AB0 A;  1AYJ A;  1NH5 A;  1ZFU A;  2BRZ A;  1BMR A;  2LJ7 A;  1ZYW A;  2LR3 A;  1AHO A;  1BRZ A;  2KBH A;  2M8B B;  2E3G A;  4HE7 A;  2LT8 A;  2GL1 A;  2I61 A;  1T7B A;  1ZVE A;  2LY6 A;  3E7U X;  1NPI A;  1T0Z A;  1T1T A;  5KK4 A;  1MR4 A;  1ZU3 A;  4CQK A;  2A7T A;  1PE4 A;  1T7A A;  1BCG A;  1NRB A;  2N66 A;  4KYP A;  2KJA A;  2SN3 A;  4V1D C;  1JXC A;  4AEI A;  1N4N A;  1PX9 A;  2B68 A;  1LQH A;  1LQQ A;  1PTX A;  1BK8 A;  1ZYV A;  1OZZ A;  1NRA A;  2LKB A;  1ZVG A;  1CHZ A;  2E0H A;  2LJM A;  1T7E A;  3PSM A;  1P0A A;  1P00 A;  1WWN A;  2ATB A;  1SNB A;  4HHF A;  2N2Q A;  1C55 A;  2KGQ A;  1I6F A;  1L4V A;  1MYN A;  5CY0 A; 
#chains in the Genus database with same CATH topology
 5AQK A;  3I33 A;  4H5N A;  5EXW A;  4UJ0 A;  5EX5 A;  2G2K A;  2E8A A;  1ZUT A;  1NGC A;  2KSK A;  2N2R A;  3C7N B;  2MZ0 A;  3L4I A;  1KAY A;  2N69 A;  4H5V A;  5FPD A;  1DQ7 A;  4GNI A;  5AQH A;  1C56 A;  5F0X A;  1GPT A;  1I6G A;  1GPS A;  3A8Y A;  5AQU A;  2KPY A;  2YC1 C;  3CQX A;  1ICA A;  5BPN A;  5AR0 A;  1CN2 A;  2KBK A;  5AQM A;  4AAZ A;  5AQL A;  5BPM A;  1VNA A;  1NE5 A;  1OMY A;  4HWI A;  3AY9 A;  1BA1 A;  1S3X A;  2B3C A;  2NY8 X;  2QWP A;  3FZL A;  3KVG A;  5F2R A;  1DKG D;  2E2F A;  1DJT A;  1SN4 A;  1FH3 A;  2LI7 A;  1I2U A;  2E3F A;  1LQI A;  1SN1 A;  2VY6 A;  2NY9 X;  1TI5 A;  1WMT A;  1K8B A;  1SEG A;  1YUW A;  3L56 A;  4FL9 A;  1KAZ A;  3FE1 A;  3HSC A;  1B3C A;  2QWL A;  3D2E B;  2KBJ A;  1KV0 A;  2ASC A;  2QWO A;  3ATV A;  3KHW A;  2YBR C;  5AQR A;  2E88 A;  4UAE F;  3E7R L;  3D2F B;  1WT7 A;  5EY4 A;  3LDP A;  3BK3 C;  2YEO A;  3KP0 A;  1HJO A;  5AQX A;  2BUP A;  3QFU A;  1NGG A;  1VNB A;  2KYQ A;  1B7D A;  3R2V A;  1JKZ A;  2JDQ D;  3GL1 A;  3M3Z A;  5AQN A;  2LY5 A;  1HPM A;  1JZA A;  1NGJ A;  1KAX A;  1JZB A;  3FZM A;  5FPM A;  4AB0 A;  1AYJ A;  3FZH A;  1NH5 A;  1NGB A;  1ZFU A;  2BRZ A;  1BUP A;  2QW9 A;  3LDO A;  1XRS B;  4H5W A;  5AQI A;  2LJ7 A;  3LDL A;  1ZYW A;  2LR3 A;  1BA0 A;  1AHO A;  2KBH A;  2M8B B;  2MBK A;  2YIL A;  2E3G A;  2V7Z A;  3CW4 A;  4H5T A;  4HE7 A;  5EVZ A;  2LT8 A;  2GL1 A;  2I61 A;  1BRZ A;  1I2V A;  1QQN A;  1T7B A;  1ZVE A;  2LY6 A;  1QQM A;  4FSV A;  1ATR A;  3E7U X;  1NPI A;  3LDQ A;  1HX1 A;  3D2E A;  1NGH A;  1T0Z A;  1T1T A;  1MR4 A;  2KHO A;  5KK4 A;  3JXU A;  3KOX A;  1ZU3 A;  5AQV A;  2A7T A;  4CQK A;  3C7N A;  1PE4 A;  2MN5 A;  1T7A A;  3D2F A;  5AQJ A;  1BCG A;  1NRB A;  5AQY A;  5F1X A;  1UGL A;  2GMO A;  3FZK A;  2N66 A;  2D56 A;  4KYP A;  1POI A;  1NGD A;  2KJA A;  2SN3 A;  1ATS A;  2QWM A;  3GDQ A;  4V1D C;  5FPE A;  1JXC A;  3FZF A;  3IUC A;  3L6Q A;  4AEI A;  1BMR A;  1NGI A;  1N4N A;  1PX9 A;  2B68 A;  2YIO A;  3KOZ A;  5BN9 A;  1LQH A;  5AQP A;  3QI7 A;  1LQQ A;  1PTX A;  1BK8 A;  1ZYV A;  1OZZ A;  4UAD E;  5AQW A;  1NRA A;  2QWQ A;  2K35 A;  5BPL A;  1NGA A;  3LDN A;  2LKB A;  3GKU A;  3QML A;  1ZVG A;  4UAF E;  3KOW A;  1CHZ A;  1NGF A;  3KOY A;  2E0H A;  5AQF A;  2LJM A;  5FPN A;  1T7E A;  2QXL A;  2QWN A;  3ATU A;  3PSM A;  1P0A A;  5AQT A;  1P00 A;  4KBO A;  1WWN A;  3KC6 A;  1NGE A;  3KP1 A;  2YIP A;  5AQS A;  5BN8 A;  2ATB A;  4H5R A;  4IO8 A;  1SNB A;  1QQO A;  3QFP A;  3SF4 D;  2QWR A;  4HHF A;  5AQO A;  5AQG A;  2N2Q A;  1C55 A;  2KGQ A;  1I6F A;  1L4V A;  2LN8 A;  5AQZ A;  5AQQ A;  1MYN A;  5CY0 A; 
#chains in the Genus database with same CATH homology
 4UJ0 A;  1ZUT A;  2N2R A;  2KSK A;  1I2V A;  2MZ0 A;  2N69 A;  1DQ7 A;  1C56 A;  1GPT A;  1I6G A;  1GPS A;  2KPY A;  2YC1 C;  1ICA A;  1CN2 A;  2KBK A;  4AAZ A;  1VNA A;  1NE5 A;  1OMY A;  2B3C A;  2NY8 X;  1FH3 A;  1DJT A;  1SN4 A;  2LI7 A;  1I2U A;  2E3F A;  1LQI A;  1SN1 A;  2NY9 X;  1TI5 A;  1WMT A;  1SEG A;  1B3C A;  2KBJ A;  1KV0 A;  2ASC A;  2YBR C;  3E7R L;  1WT7 A;  2YEO A;  2KYQ A;  1VNB A;  1B7D A;  1JKZ A;  2LY5 A;  1JZA A;  1JZB A;  4AB0 A;  1AYJ A;  1NH5 A;  1ZFU A;  2BRZ A;  1BMR A;  2LJ7 A;  1ZYW A;  2LR3 A;  1AHO A;  1BRZ A;  2KBH A;  2M8B B;  2E3G A;  4HE7 A;  2LT8 A;  2GL1 A;  2I61 A;  1T7B A;  1ZVE A;  2LY6 A;  3E7U X;  1NPI A;  1T0Z A;  1T1T A;  5KK4 A;  1MR4 A;  1ZU3 A;  4CQK A;  2A7T A;  1PE4 A;  1T7A A;  1BCG A;  1NRB A;  2N66 A;  4KYP A;  2KJA A;  2SN3 A;  4V1D C;  1JXC A;  4AEI A;  1N4N A;  1PX9 A;  2B68 A;  1LQH A;  1LQQ A;  1PTX A;  1BK8 A;  1ZYV A;  1OZZ A;  1NRA A;  2LKB A;  1ZVG A;  1CHZ A;  2E0H A;  2LJM A;  1T7E A;  3PSM A;  1P0A A;  1P00 A;  1WWN A;  2ATB A;  1SNB A;  4HHF A;  2N2Q A;  1C55 A;  2KGQ A;  1I6F A;  1L4V A;  1MYN A;  5CY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...