2LT8A

Eurocin solution structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
42
structure length
42
Chain Sequence
b'GFGCPGDAYQCSEHCRALGGGRTGGYCAGPWYLGHPTCTCSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords eurocin
publication title Eurocin, a New Fungal Defensin: STRUCTURE, LIPID BINDING, AND ITS MODE OF ACTION.
pubmed doi rcsb
source organism Eurotium amstelodami
molecule tags Antimicrobial protein
total genus 7
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01097 Defensin_2 Arthropod defensin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2lt8A01
1P00A 1JXCA 1SN4A 1ZYWA 2I61A 2KBHA 1CN2A 1BK8A 1C55A 2LT8A 1TI5A 1CHZA 1PX9A 1MYNA 2LJ7A 1B3CA 2MZ0A 1DJTA 1GPTA 2KYQA 4CQKA 4UJ0A 2E3GA 1WMTA 2LI7A 5KK4A 1I6GA 2N66A 1LQIA 1L4VA 2YC1C 4AAZA 1ZU3A 1ZFUA 4V1DC 1ZVEA 2YBRC 1C56A 2N2RA 1I2VA 1WWNA 1SNBA 2B3CA 1T7BA 3E7UX 1AYJA 1JKZA 1FH3A 5CY0A 2LY6A 1ZYVA 2LY5A 1N4NA 1T7AA 2LR3A 2SN3A 2GL1A 1AHOA 2ASCA 1ICAA 1SN1A 2ATBA 1BRZA 1DQ7A 1T0ZA 1BMRA 1MR4A 2KGQA 1P0AA 2LJMA 2NY8X 2KJAA 1VNAA 1PE4A 1GPSA 1T1TA 1T7EA 1I2UA 3E7RL 1ZVGA 1SEGA 2YEOA 1I6FA 2N2QA 4HHFA 2NY9X 2E0HA 1OZZA 2KPYA 1VNBA 2E3FA 3PSMA 1WT7A 2A7TA 4AB0A 1ZUTA 4HE7A 1NPIA 2M8BB 4KYPA 1LQHA 1JZBA 1NRBA 1JZAA 2BRZA 1PTXA 2N69A 1B7DA 2KBJA 1OMYA 2LKBA 1LQQA 2KSKA 1NH5A 2KBKA 2B68A 1NE5A 1NRAA 4AEIA 1BCGA 1KV0A
chains in the Genus database with same CATH superfamily
1P00A 2GMOA 5BPMA 3C7NB 1QQMA 2QWMA 1JXCA 1SN4A 1S3XA 1ZYWA 2I61A 2KBHA 3C7NA 1CN2A 1BK8A 2QWNA 5FPDA 1KAXA 1NGEA 1ATSA 1C55A 2LT8A 3KP1A 1TI5A 2QWQA 1CHZA 3L56A 5AQHA 5AQFA 2E8AA 3R2VA 2QWLA 4UAEF 3KOWA 3QFPA 3FZKA 1PX9A 3I33A 3CQXA 1MYNA 2K35A 3LDQA 2LJ7A 5AQUA 4H5NA 3KOYA 1B3CA 3AY9A 2MZ0A 5AQMA 1DJTA 1NGHA 3D2EB 3IUCA 5F0XA 1GPTA 4H5TA 2KYQA 2JDQD 4CQKA 4UJ0A 2E3GA 1WMTA 5AQZA 2YIOA 5AQWA 2LI7A 5AQVA 5KK4A 1I6GA 5BPLA 2N66A 2YILA 3LDPA 1LQIA 5FPNA 1L4VA 2YC1C 3KVGA 3QMLA 1QQNA 5AQJA 4AAZA 1ZU3A 2QXLA 1ZFUA 4V1DC 1ZVEA 5AQOA 2YBRC 2QWOA 3ATUA 1NGDA 4H5RA 3L4IA 1C56A 4FSVA 4HWIA 3FZMA 2N2RA 3SF4D 1I2VA 5AQTA 5EVZA 1WWNA 3FZFA 3GDQA 1NGGA 1SNBA 1XRSB 2B3CA 1T7BA 3FZLA 3E7UX 1HX1A 5AQIA 5EY4A 3FE1A 5AQGA 3CW4A 1AYJA 4H5VA 2MN5A 3L6QA 1JKZA 1FH3A 3QFUA 3LDNA 5CY0A 1NGAA 2LY6A 1ZYVA 1KAZA 2V7ZA 4GNIA 2LY5A 1N4NA 1T7AA 2LR3A 3QI7A 1BUPA 5AQSA 3D2FB 2SN3A 2GL1A 3D2FA 1AHOA 2YIPA 2BUPA 1YUWA 2ASCA 3KOXA 1ICAA 1SN1A 2ATBA 5AQQA 1DQ7A 1T0ZA 1BRZA 5EX5A 1BMRA 1ATRA 1POIA 1MR4A 2KGQA 1P0AA 2KHOA 2QWPA 1BA0A 5AQYA 1K8BA 2LJMA 2NY8X 1BA1A 2VY6A 5F1XA 1NGCA 2KJAA 3KOZA 1VNAA 1PE4A 1GPSA 1T1TA 1T7EA 3A8YA 5AQXA 1I2UA 3E7RL 1ZVGA 1SEGA 5AQRA 2YEOA 1I6FA 2N2QA 4HHFA 1KAYA 2NY9X 2E0HA 3HSCA 4KBOA 1UGLA 1OZZA 1NGIA 2KPYA 1VNBA 3LDLA 2E3FA 3M3ZA 4FL9A 3PSMA 5BPNA 4UADE 2QW9A 1WT7A 2A7TA 4AB0A 3GKUA 1ZUTA 4HE7A 1NPIA 1HJOA 2M8BB 3KHWA 1QQOA 3KP0A 4H5WA 4KYPA 1LQHA 1JZBA 2LN8A 3LDOA 1NRBA 1JZAA 4IO8A 1NGFA 2G2KA 5BN9A 5FPMA 2BRZA 1HPMA 1PTXA 2N69A 5BN8A 5AQKA 1B7DA 2D56A 3BK3C 2E2FA 2KBJA 3ATVA 1OMYA 2MBKA 5AR0A 1NGJA 2LKBA 3D2EA 5AQLA 1LQQA 3KC6A 5EXWA 2KSKA 5F2RA 1DKGD 4UAFE 1NH5A 1NGBA 2E88A 2KBKA 2B68A 1NE5A 5FPEA 1NRAA 3JXUA 3GL1A 4AEIA 5AQPA 1BCGA 2QWRA 5AQNA 1KV0A 3FZHA
chains in the Genus database with same CATH topology
1P00A 1JXCA 1SN4A 1ZYWA 2I61A 2KBHA 1CN2A 1BK8A 1C55A 2LT8A 1TI5A 1CHZA 1PX9A 1MYNA 2LJ7A 1B3CA 2MZ0A 1DJTA 1GPTA 2KYQA 4CQKA 4UJ0A 2E3GA 1WMTA 2LI7A 5KK4A 1I6GA 2N66A 1LQIA 1L4VA 2YC1C 4AAZA 1ZU3A 1ZFUA 4V1DC 1ZVEA 2YBRC 1C56A 2N2RA 1I2VA 1WWNA 1SNBA 2B3CA 1T7BA 3E7UX 1AYJA 1JKZA 1FH3A 5CY0A 2LY6A 1ZYVA 2LY5A 1N4NA 1T7AA 2LR3A 2SN3A 2GL1A 1AHOA 2ASCA 1ICAA 1SN1A 2ATBA 1BRZA 1DQ7A 1T0ZA 1BMRA 1MR4A 2KGQA 1P0AA 2LJMA 2NY8X 2KJAA 1VNAA 1PE4A 1GPSA 1T1TA 1T7EA 1I2UA 3E7RL 1ZVGA 1SEGA 2YEOA 1I6FA 2N2QA 4HHFA 2NY9X 2E0HA 1OZZA 2KPYA 1VNBA 2E3FA 3PSMA 1WT7A 2A7TA 4AB0A 1ZUTA 4HE7A 1NPIA 2M8BB 4KYPA 1LQHA 1JZBA 1NRBA 1JZAA 2BRZA 1PTXA 2N69A 1B7DA 2KBJA 1OMYA 2LKBA 1LQQA 2KSKA 1NH5A 2KBKA 2B68A 1NE5A 1NRAA 4AEIA 1BCGA 1KV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P00 A;  1JXC A;  1SN4 A;  1ZYW A;  2I61 A;  2KBH A;  1CN2 A;  1BK8 A;  1C55 A;  2LT8 A;  1TI5 A;  1CHZ A;  1PX9 A;  1MYN A;  2LJ7 A;  1B3C A;  2MZ0 A;  1DJT A;  1GPT A;  2KYQ A;  4CQK A;  4UJ0 A;  2E3G A;  1WMT A;  2LI7 A;  5KK4 A;  1I6G A;  2N66 A;  1LQI A;  1L4V A;  2YC1 C;  4AAZ A;  1ZU3 A;  1ZFU A;  4V1D C;  1ZVE A;  2YBR C;  1C56 A;  2N2R A;  1I2V A;  1WWN A;  1SNB A;  2B3C A;  1T7B A;  3E7U X;  1AYJ A;  1JKZ A;  1FH3 A;  5CY0 A;  2LY6 A;  1ZYV A;  2LY5 A;  1N4N A;  1T7A A;  2LR3 A;  2SN3 A;  2GL1 A;  1AHO A;  2ASC A;  1ICA A;  1SN1 A;  2ATB A;  1BRZ A;  1DQ7 A;  1T0Z A;  1BMR A;  1MR4 A;  2KGQ A;  1P0A A;  2LJM A;  2NY8 X;  2KJA A;  1VNA A;  1PE4 A;  1GPS A;  1T1T A;  1T7E A;  1I2U A;  3E7R L;  1ZVG A;  1SEG A;  2YEO A;  1I6F A;  2N2Q A;  4HHF A;  2NY9 X;  2E0H A;  1OZZ A;  2KPY A;  1VNB A;  2E3F A;  3PSM A;  1WT7 A;  2A7T A;  4AB0 A;  1ZUT A;  4HE7 A;  1NPI A;  2M8B B;  4KYP A;  1LQH A;  1JZB A;  1NRB A;  1JZA A;  2BRZ A;  1PTX A;  2N69 A;  1B7D A;  2KBJ A;  1OMY A;  2LKB A;  1LQQ A;  2KSK A;  1NH5 A;  2KBK A;  2B68 A;  1NE5 A;  1NRA A;  4AEI A;  1BCG A;  1KV0 A; 
#chains in the Genus database with same CATH topology
 1P00 A;  2GMO A;  5BPM A;  3C7N B;  1QQM A;  2QWM A;  1JXC A;  1SN4 A;  1S3X A;  1ZYW A;  2I61 A;  2KBH A;  3C7N A;  1CN2 A;  1BK8 A;  2QWN A;  5FPD A;  1KAX A;  1NGE A;  1ATS A;  1C55 A;  2LT8 A;  3KP1 A;  1TI5 A;  2QWQ A;  1CHZ A;  3L56 A;  5AQH A;  5AQF A;  2E8A A;  3R2V A;  2QWL A;  4UAE F;  3KOW A;  3QFP A;  3FZK A;  1PX9 A;  3I33 A;  3CQX A;  1MYN A;  2K35 A;  3LDQ A;  2LJ7 A;  5AQU A;  4H5N A;  3KOY A;  1B3C A;  3AY9 A;  2MZ0 A;  5AQM A;  1DJT A;  1NGH A;  3D2E B;  3IUC A;  5F0X A;  1GPT A;  4H5T A;  2KYQ A;  2JDQ D;  4CQK A;  4UJ0 A;  2E3G A;  1WMT A;  5AQZ A;  2YIO A;  5AQW A;  2LI7 A;  5AQV A;  5KK4 A;  1I6G A;  5BPL A;  2N66 A;  2YIL A;  3LDP A;  1LQI A;  5FPN A;  1L4V A;  2YC1 C;  3KVG A;  3QML A;  1QQN A;  5AQJ A;  4AAZ A;  1ZU3 A;  2QXL A;  1ZFU A;  4V1D C;  1ZVE A;  5AQO A;  2YBR C;  2QWO A;  3ATU A;  1NGD A;  4H5R A;  3L4I A;  1C56 A;  4FSV A;  4HWI A;  3FZM A;  2N2R A;  3SF4 D;  1I2V A;  5AQT A;  5EVZ A;  1WWN A;  3FZF A;  3GDQ A;  1NGG A;  1SNB A;  1XRS B;  2B3C A;  1T7B A;  3FZL A;  3E7U X;  1HX1 A;  5AQI A;  5EY4 A;  3FE1 A;  5AQG A;  3CW4 A;  1AYJ A;  4H5V A;  2MN5 A;  3L6Q A;  1JKZ A;  1FH3 A;  3QFU A;  3LDN A;  5CY0 A;  1NGA A;  2LY6 A;  1ZYV A;  1KAZ A;  2V7Z A;  4GNI A;  2LY5 A;  1N4N A;  1T7A A;  2LR3 A;  3QI7 A;  1BUP A;  5AQS A;  3D2F B;  2SN3 A;  2GL1 A;  3D2F A;  1AHO A;  2YIP A;  2BUP A;  1YUW A;  2ASC A;  3KOX A;  1ICA A;  1SN1 A;  2ATB A;  5AQQ A;  1DQ7 A;  1T0Z A;  1BRZ A;  5EX5 A;  1BMR A;  1ATR A;  1POI A;  1MR4 A;  2KGQ A;  1P0A A;  2KHO A;  2QWP A;  1BA0 A;  5AQY A;  1K8B A;  2LJM A;  2NY8 X;  1BA1 A;  2VY6 A;  5F1X A;  1NGC A;  2KJA A;  3KOZ A;  1VNA A;  1PE4 A;  1GPS A;  1T1T A;  1T7E A;  3A8Y A;  5AQX A;  1I2U A;  3E7R L;  1ZVG A;  1SEG A;  5AQR A;  2YEO A;  1I6F A;  2N2Q A;  4HHF A;  1KAY A;  2NY9 X;  2E0H A;  3HSC A;  4KBO A;  1UGL A;  1OZZ A;  1NGI A;  2KPY A;  1VNB A;  3LDL A;  2E3F A;  3M3Z A;  4FL9 A;  3PSM A;  5BPN A;  4UAD E;  2QW9 A;  1WT7 A;  2A7T A;  4AB0 A;  3GKU A;  1ZUT A;  4HE7 A;  1NPI A;  1HJO A;  2M8B B;  3KHW A;  1QQO A;  3KP0 A;  4H5W A;  4KYP A;  1LQH A;  1JZB A;  2LN8 A;  3LDO A;  1NRB A;  1JZA A;  4IO8 A;  1NGF A;  2G2K A;  5BN9 A;  5FPM A;  2BRZ A;  1HPM A;  1PTX A;  2N69 A;  5BN8 A;  5AQK A;  1B7D A;  2D56 A;  3BK3 C;  2E2F A;  2KBJ A;  3ATV A;  1OMY A;  2MBK A;  5AR0 A;  1NGJ A;  2LKB A;  3D2E A;  5AQL A;  1LQQ A;  3KC6 A;  5EXW A;  2KSK A;  5F2R A;  1DKG D;  4UAF E;  1NH5 A;  1NGB A;  2E88 A;  2KBK A;  2B68 A;  1NE5 A;  5FPE A;  1NRA A;  3JXU A;  3GL1 A;  4AEI A;  5AQP A;  1BCG A;  2QWR A;  5AQN A;  1KV0 A;  3FZH A; 
#chains in the Genus database with same CATH homology
 1P00 A;  1JXC A;  1SN4 A;  1ZYW A;  2I61 A;  2KBH A;  1CN2 A;  1BK8 A;  1C55 A;  2LT8 A;  1TI5 A;  1CHZ A;  1PX9 A;  1MYN A;  2LJ7 A;  1B3C A;  2MZ0 A;  1DJT A;  1GPT A;  2KYQ A;  4CQK A;  4UJ0 A;  2E3G A;  1WMT A;  2LI7 A;  5KK4 A;  1I6G A;  2N66 A;  1LQI A;  1L4V A;  2YC1 C;  4AAZ A;  1ZU3 A;  1ZFU A;  4V1D C;  1ZVE A;  2YBR C;  1C56 A;  2N2R A;  1I2V A;  1WWN A;  1SNB A;  2B3C A;  1T7B A;  3E7U X;  1AYJ A;  1JKZ A;  1FH3 A;  5CY0 A;  2LY6 A;  1ZYV A;  2LY5 A;  1N4N A;  1T7A A;  2LR3 A;  2SN3 A;  2GL1 A;  1AHO A;  2ASC A;  1ICA A;  1SN1 A;  2ATB A;  1BRZ A;  1DQ7 A;  1T0Z A;  1BMR A;  1MR4 A;  2KGQ A;  1P0A A;  2LJM A;  2NY8 X;  2KJA A;  1VNA A;  1PE4 A;  1GPS A;  1T1T A;  1T7E A;  1I2U A;  3E7R L;  1ZVG A;  1SEG A;  2YEO A;  1I6F A;  2N2Q A;  4HHF A;  2NY9 X;  2E0H A;  1OZZ A;  2KPY A;  1VNB A;  2E3F A;  3PSM A;  1WT7 A;  2A7T A;  4AB0 A;  1ZUT A;  4HE7 A;  1NPI A;  2M8B B;  4KYP A;  1LQH A;  1JZB A;  1NRB A;  1JZA A;  2BRZ A;  1PTX A;  2N69 A;  1B7D A;  2KBJ A;  1OMY A;  2LKB A;  1LQQ A;  2KSK A;  1NH5 A;  2KBK A;  2B68 A;  1NE5 A;  1NRA A;  4AEI A;  1BCG A;  1KV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...