1I6FA

Nmr solution structure of the insect-specific neurotoxin variant 5 (cse-v5) from the scorpion centruroides sculpturatus ewing
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
KDGYPVDSKGCKLSCVANNYCDNQCKMKKASGGHCYAMSCYCEGLPENAKVSDSATNICG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROTOXIN V-5
publication title Solution structure of an insect-specific neurotoxin from the New World scorpion Centruroides sculpturatus Ewing.
pubmed doi rcsb
molecule tags Toxin
total genus 11
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1i6fA00
1JZBA 2KGQA 4V1DC 4CQKA 2YC1C 2KBJA 1N4NA 4UJ0A 1SNBA 1BCGA 3PSMA 1ZUTA 1PTXA 2LT8A 1LQIA 4AEIA 1NRAA 2KBHA 2N66A 1CHZA 2KSKA 1ICAA 2LI7A 1MR4A 1ZYVA 1NH5A 1P0AA 2KYQA 1BMRA 1FH3A 1WT7A 1ZFUA 2YBRC 1PE4A 2B3CA 2LKBA 1OMYA 1KV0A 1OZZA 1SN4A 2YEOA 1NE5A 2N2RA 2I61A 1AHOA 1DJTA 1LQQA 5CY0A 1ZU3A 1JZAA 2KPYA 1GPSA 1I2VA 4HHFA 2E3FA 4AAZA 1SN1A 1CN2A 1VNBA 2KBKA 1L4VA 2BRZA 1I2UA 2E3GA 2N2QA 1T7EA 1VNAA 1MYNA 2MZ0A 1BRZA 2A7TA 1GPTA 2ASCA 2N69A 1ZVEA 2SN3A 2B68A 1BK8A 4KYPA 1NPIA 2LY6A 2M8BB 1DQ7A 4HE7A 1T7BA 1B3CA 3E7RL 1WMTA 2NY9X 2LJMA 2LR3A 1ZVGA 1NRBA 5KK4A 1AYJA 1T7AA 1SEGA 1C56A 4AB0A 1I6GA 3E7UX 1LQHA 1JXCA 1P00A 1WWNA 2NY8X 1JKZA 2LY5A 2ATBA 2KJAA 1T1TA 1B7DA 2GL1A 1TI5A 2E0HA 2LJ7A 1ZYWA 1PX9A 1T0ZA 1C55A 1I6FA
chains in the Genus database with same CATH superfamily
1JZBA 2KGQA 3KC6A 1NGDA 4V1DC 4CQKA 2YC1C 3SF4D 2KBJA 5EX5A 1N4NA 3ATUA 5AQMA 4UJ0A 2JDQD 2QWOA 5AQOA 5AQTA 1SNBA 1BCGA 2G2KA 1HJOA 5AQUA 3PSMA 3QFUA 1ZUTA 1NGAA 1PTXA 3FZMA 2LT8A 1LQIA 3GL1A 4FSVA 5AQRA 5EXWA 5EY4A 4AEIA 1BA0A 3D2EA 3FZHA 5AQXA 1NRAA 2KBHA 3D2EB 1NGIA 2N66A 1ATRA 1CHZA 2KSKA 3L6QA 1ICAA 2LI7A 1MR4A 3JXUA 5FPNA 1QQMA 3ATVA 5AQNA 3LDQA 5BN9A 4FL9A 1ZYVA 5EVZA 5AQVA 3C7NA 1NH5A 1BA1A 1P0AA 4GNIA 5AQLA 1QQNA 3FE1A 1NGFA 4KBOA 3LDNA 1HPMA 2KYQA 3CW4A 3KVGA 3CQXA 1BMRA 2V7ZA 2YIPA 2E8AA 1FH3A 1BUPA 4UAEF 3KHWA 1WT7A 1ZFUA 2YBRC 1PE4A 1UGLA 3FZFA 3KOYA 2B3CA 1OMYA 1KV0A 1OZZA 1SN4A 2LKBA 1POIA 2D56A 2YEOA 1NE5A 2N2RA 3D2FB 2I61A 5FPMA 1AHOA 1DJTA 1LQQA 3HSCA 5CY0A 1NGHA 1JZAA 1ZU3A 2KPYA 2QW9A 4UAFE 5AQWA 1GPSA 1I2VA 3LDOA 3GDQA 2E3FA 4HHFA 4AAZA 1SN1A 1YUWA 1CN2A 1VNBA 1XRSB 3KOZA 2MN5A 2KBKA 4H5RA 5AQJA 2BRZA 2BUPA 5BPNA 1L4VA 1I2UA 3L4IA 1KAYA 2E3GA 2N2QA 1T7EA 2K35A 2QWRA 1VNAA 1MYNA 2QWPA 5AQGA 3R2VA 1NGEA 1NGJA 2MZ0A 2E88A 1BRZA 2A7TA 1GPTA 2ASCA 2N69A 3L56A 1ZVEA 5AQKA 4HWIA 2SN3A 2B68A 1BK8A 4KYPA 1NPIA 2LY6A 2M8BB 3D2FA 1DQ7A 5BPLA 1S3XA 4HE7A 1T7BA 1B3CA 3E7RL 3I33A 1WMTA 2LN8A 3FZKA 3QFPA 2NY9X 2QWQA 2LJMA 2LR3A 1ZVGA 2YILA 3KP1A 5AQQA 1NRBA 5AQYA 5AQHA 2QXLA 5KK4A 5F2RA 3A8YA 5AQSA 1AYJA 1KAXA 2E2FA 3BK3C 1ATSA 3IUCA 1NGCA 2KHOA 1T7AA 5AR0A 1SEGA 2GMOA 2VY6A 3AY9A 1C56A 5F0XA 4AB0A 4H5NA 3KOXA 1I6GA 3E7UX 3LDLA 1K8BA 1LQHA 1JXCA 1P00A 2MBKA 3GKUA 4H5TA 1WWNA 1KAZA 1NGBA 2NY8X 3QMLA 5AQZA 1QQOA 1JKZA 5AQIA 1DKGD 2ATBA 2KJAA 2LY5A 2QWMA 3FZLA 5AQFA 5BN8A 5BPMA 1T1TA 1NGGA 3QI7A 1B7DA 4UADE 2GL1A 5F1XA 5FPEA 1TI5A 2E0HA 2LJ7A 1HX1A 2QWLA 1ZYWA 4H5WA 5FPDA 2QWNA 4IO8A 5AQPA 3M3ZA 1PX9A 3C7NB 4H5VA 1T0ZA 3LDPA 3KOWA 1C55A 3KP0A 1I6FA 2YIOA
chains in the Genus database with same CATH topology
1JZBA 2KGQA 4V1DC 4CQKA 2YC1C 2KBJA 1N4NA 4UJ0A 1SNBA 1BCGA 3PSMA 1ZUTA 1PTXA 2LT8A 1LQIA 4AEIA 1NRAA 2KBHA 2N66A 1CHZA 2KSKA 1ICAA 2LI7A 1MR4A 1ZYVA 1NH5A 1P0AA 2KYQA 1BMRA 1FH3A 1WT7A 1ZFUA 2YBRC 1PE4A 2B3CA 2LKBA 1OMYA 1KV0A 1OZZA 1SN4A 2YEOA 1NE5A 2N2RA 2I61A 1AHOA 1DJTA 1LQQA 5CY0A 1ZU3A 1JZAA 2KPYA 1GPSA 1I2VA 4HHFA 2E3FA 4AAZA 1SN1A 1CN2A 1VNBA 2KBKA 1L4VA 2BRZA 1I2UA 2E3GA 2N2QA 1T7EA 1VNAA 1MYNA 2MZ0A 1BRZA 2A7TA 1GPTA 2ASCA 2N69A 1ZVEA 2SN3A 2B68A 1BK8A 4KYPA 1NPIA 2LY6A 2M8BB 1DQ7A 4HE7A 1T7BA 1B3CA 3E7RL 1WMTA 2NY9X 2LJMA 2LR3A 1ZVGA 1NRBA 5KK4A 1AYJA 1T7AA 1SEGA 1C56A 4AB0A 1I6GA 3E7UX 1LQHA 1JXCA 1P00A 1WWNA 2NY8X 1JKZA 2LY5A 2ATBA 2KJAA 1T1TA 1B7DA 2GL1A 1TI5A 2E0HA 2LJ7A 1ZYWA 1PX9A 1T0ZA 1C55A 1I6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZB A;  2KGQ A;  4V1D C;  4CQK A;  2YC1 C;  2KBJ A;  1N4N A;  4UJ0 A;  1SNB A;  1BCG A;  3PSM A;  1ZUT A;  1PTX A;  2LT8 A;  1LQI A;  4AEI A;  1NRA A;  2KBH A;  2N66 A;  1CHZ A;  2KSK A;  1ICA A;  2LI7 A;  1MR4 A;  1ZYV A;  1NH5 A;  1P0A A;  2KYQ A;  1BMR A;  1FH3 A;  1WT7 A;  1ZFU A;  2YBR C;  1PE4 A;  2B3C A;  2LKB A;  1OMY A;  1KV0 A;  1OZZ A;  1SN4 A;  2YEO A;  1NE5 A;  2N2R A;  2I61 A;  1AHO A;  1DJT A;  1LQQ A;  5CY0 A;  1ZU3 A;  1JZA A;  2KPY A;  1GPS A;  1I2V A;  4HHF A;  2E3F A;  4AAZ A;  1SN1 A;  1CN2 A;  1VNB A;  2KBK A;  1L4V A;  2BRZ A;  1I2U A;  2E3G A;  2N2Q A;  1T7E A;  1VNA A;  1MYN A;  2MZ0 A;  1BRZ A;  2A7T A;  1GPT A;  2ASC A;  2N69 A;  1ZVE A;  2SN3 A;  2B68 A;  1BK8 A;  4KYP A;  1NPI A;  2LY6 A;  2M8B B;  1DQ7 A;  4HE7 A;  1T7B A;  1B3C A;  3E7R L;  1WMT A;  2NY9 X;  2LJM A;  2LR3 A;  1ZVG A;  1NRB A;  5KK4 A;  1AYJ A;  1T7A A;  1SEG A;  1C56 A;  4AB0 A;  1I6G A;  3E7U X;  1LQH A;  1JXC A;  1P00 A;  1WWN A;  2NY8 X;  1JKZ A;  2LY5 A;  2ATB A;  2KJA A;  1T1T A;  1B7D A;  2GL1 A;  1TI5 A;  2E0H A;  2LJ7 A;  1ZYW A;  1PX9 A;  1T0Z A;  1C55 A;  1I6F A; 
#chains in the Genus database with same CATH topology
 1JZB A;  2KGQ A;  3KC6 A;  1NGD A;  4V1D C;  4CQK A;  2YC1 C;  3SF4 D;  2KBJ A;  5EX5 A;  1N4N A;  3ATU A;  5AQM A;  4UJ0 A;  2JDQ D;  2QWO A;  5AQO A;  5AQT A;  1SNB A;  1BCG A;  2G2K A;  1HJO A;  5AQU A;  3PSM A;  3QFU A;  1ZUT A;  1NGA A;  1PTX A;  3FZM A;  2LT8 A;  1LQI A;  3GL1 A;  4FSV A;  5AQR A;  5EXW A;  5EY4 A;  4AEI A;  1BA0 A;  3D2E A;  3FZH A;  5AQX A;  1NRA A;  2KBH A;  3D2E B;  1NGI A;  2N66 A;  1ATR A;  1CHZ A;  2KSK A;  3L6Q A;  1ICA A;  2LI7 A;  1MR4 A;  3JXU A;  5FPN A;  1QQM A;  3ATV A;  5AQN A;  3LDQ A;  5BN9 A;  4FL9 A;  1ZYV A;  5EVZ A;  5AQV A;  3C7N A;  1NH5 A;  1BA1 A;  1P0A A;  4GNI A;  5AQL A;  1QQN A;  3FE1 A;  1NGF A;  4KBO A;  3LDN A;  1HPM A;  2KYQ A;  3CW4 A;  3KVG A;  3CQX A;  1BMR A;  2V7Z A;  2YIP A;  2E8A A;  1FH3 A;  1BUP A;  4UAE F;  3KHW A;  1WT7 A;  1ZFU A;  2YBR C;  1PE4 A;  1UGL A;  3FZF A;  3KOY A;  2B3C A;  1OMY A;  1KV0 A;  1OZZ A;  1SN4 A;  2LKB A;  1POI A;  2D56 A;  2YEO A;  1NE5 A;  2N2R A;  3D2F B;  2I61 A;  5FPM A;  1AHO A;  1DJT A;  1LQQ A;  3HSC A;  5CY0 A;  1NGH A;  1JZA A;  1ZU3 A;  2KPY A;  2QW9 A;  4UAF E;  5AQW A;  1GPS A;  1I2V A;  3LDO A;  3GDQ A;  2E3F A;  4HHF A;  4AAZ A;  1SN1 A;  1YUW A;  1CN2 A;  1VNB A;  1XRS B;  3KOZ A;  2MN5 A;  2KBK A;  4H5R A;  5AQJ A;  2BRZ A;  2BUP A;  5BPN A;  1L4V A;  1I2U A;  3L4I A;  1KAY A;  2E3G A;  2N2Q A;  1T7E A;  2K35 A;  2QWR A;  1VNA A;  1MYN A;  2QWP A;  5AQG A;  3R2V A;  1NGE A;  1NGJ A;  2MZ0 A;  2E88 A;  1BRZ A;  2A7T A;  1GPT A;  2ASC A;  2N69 A;  3L56 A;  1ZVE A;  5AQK A;  4HWI A;  2SN3 A;  2B68 A;  1BK8 A;  4KYP A;  1NPI A;  2LY6 A;  2M8B B;  3D2F A;  1DQ7 A;  5BPL A;  1S3X A;  4HE7 A;  1T7B A;  1B3C A;  3E7R L;  3I33 A;  1WMT A;  2LN8 A;  3FZK A;  3QFP A;  2NY9 X;  2QWQ A;  2LJM A;  2LR3 A;  1ZVG A;  2YIL A;  3KP1 A;  5AQQ A;  1NRB A;  5AQY A;  5AQH A;  2QXL A;  5KK4 A;  5F2R A;  3A8Y A;  5AQS A;  1AYJ A;  1KAX A;  2E2F A;  3BK3 C;  1ATS A;  3IUC A;  1NGC A;  2KHO A;  1T7A A;  5AR0 A;  1SEG A;  2GMO A;  2VY6 A;  3AY9 A;  1C56 A;  5F0X A;  4AB0 A;  4H5N A;  3KOX A;  1I6G A;  3E7U X;  3LDL A;  1K8B A;  1LQH A;  1JXC A;  1P00 A;  2MBK A;  3GKU A;  4H5T A;  1WWN A;  1KAZ A;  1NGB A;  2NY8 X;  3QML A;  5AQZ A;  1QQO A;  1JKZ A;  5AQI A;  1DKG D;  2ATB A;  2KJA A;  2LY5 A;  2QWM A;  3FZL A;  5AQF A;  5BN8 A;  5BPM A;  1T1T A;  1NGG A;  3QI7 A;  1B7D A;  4UAD E;  2GL1 A;  5F1X A;  5FPE A;  1TI5 A;  2E0H A;  2LJ7 A;  1HX1 A;  2QWL A;  1ZYW A;  4H5W A;  5FPD A;  2QWN A;  4IO8 A;  5AQP A;  3M3Z A;  1PX9 A;  3C7N B;  4H5V A;  1T0Z A;  3LDP A;  3KOW A;  1C55 A;  3KP0 A;  1I6F A;  2YIO A; 
#chains in the Genus database with same CATH homology
 1JZB A;  2KGQ A;  4V1D C;  4CQK A;  2YC1 C;  2KBJ A;  1N4N A;  4UJ0 A;  1SNB A;  1BCG A;  3PSM A;  1ZUT A;  1PTX A;  2LT8 A;  1LQI A;  4AEI A;  1NRA A;  2KBH A;  2N66 A;  1CHZ A;  2KSK A;  1ICA A;  2LI7 A;  1MR4 A;  1ZYV A;  1NH5 A;  1P0A A;  2KYQ A;  1BMR A;  1FH3 A;  1WT7 A;  1ZFU A;  2YBR C;  1PE4 A;  2B3C A;  2LKB A;  1OMY A;  1KV0 A;  1OZZ A;  1SN4 A;  2YEO A;  1NE5 A;  2N2R A;  2I61 A;  1AHO A;  1DJT A;  1LQQ A;  5CY0 A;  1ZU3 A;  1JZA A;  2KPY A;  1GPS A;  1I2V A;  4HHF A;  2E3F A;  4AAZ A;  1SN1 A;  1CN2 A;  1VNB A;  2KBK A;  1L4V A;  2BRZ A;  1I2U A;  2E3G A;  2N2Q A;  1T7E A;  1VNA A;  1MYN A;  2MZ0 A;  1BRZ A;  2A7T A;  1GPT A;  2ASC A;  2N69 A;  1ZVE A;  2SN3 A;  2B68 A;  1BK8 A;  4KYP A;  1NPI A;  2LY6 A;  2M8B B;  1DQ7 A;  4HE7 A;  1T7B A;  1B3C A;  3E7R L;  1WMT A;  2NY9 X;  2LJM A;  2LR3 A;  1ZVG A;  1NRB A;  5KK4 A;  1AYJ A;  1T7A A;  1SEG A;  1C56 A;  4AB0 A;  1I6G A;  3E7U X;  1LQH A;  1JXC A;  1P00 A;  1WWN A;  2NY8 X;  1JKZ A;  2LY5 A;  2ATB A;  2KJA A;  1T1T A;  1B7D A;  2GL1 A;  1TI5 A;  2E0H A;  2LJ7 A;  1ZYW A;  1PX9 A;  1T0Z A;  1C55 A;  1I6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...