4UADE

Importin alpha 7 delta ibb in complex with influenza pb2 nuclear localization domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
75
structure length
75
Chain Sequence
TSGVESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Importin subunit alpha-7
publication title Molecular Determinants for Nuclear Import of Influenza A PB2 by Importin alpha Isoforms 3 and 7.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2014-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 4uadE00
3KHWA 2JDQD 3KC6A 3L56A 3CW4A 2GMOA 4UAEF 2VY6A 4UAFE 3R2VA 4UADE
chains in the Genus database with same CATH superfamily
1BMRA 1DQ7A 3FE1A 3KHWA 5AQXA 3KP0A 2JDQD 1S3XA 4UJ0A 2QWOA 1HJOA 2E3GA 3R2VA 1OZZA 5BPMA 1T7EA 2N2QA 5AQNA 1NGIA 4H5VA 3IUCA 4AAZA 2KYQA 1YUWA 1LQIA 1PX9A 3JXUA 2V7ZA 1JXCA 3LDQA 1C56A 1N4NA 2E2FA 5AQYA 1UGLA 2GL1A 3LDPA 1HPMA 1NGFA 1NH5A 1NPIA 4IO8A 3CQXA 1OMYA 2NY9X 2LR3A 3CW4A 5AQOA 5AQLA 5AQZA 5KK4A 4H5NA 2B68A 1WWNA 2E88A 5AQGA 5AQSA 3KVGA 5F2RA 1KAYA 2N2RA 1CN2A 3C7NB 2ATBA 1NGBA 1ZFUA 2QW9A 1MYNA 3QI7A 4HWIA 5EVZA 2KJAA 1NGDA 2QWLA 3GL1A 5FPDA 2YEOA 2KBHA 2KSKA 1VNAA 3LDNA 1P00A 1QQOA 1XRSB 2G2KA 2LI7A 3AY9A 1ATRA 1ZVGA 3HSCA 3I33A 3L4IA 2N69A 4UAEF 1FH3A 1LQHA 3GKUA 3KOZA 1SNBA 5AR0A 4CQKA 1NGHA 5EXWA 1DJTA 1SN1A 2YIPA 3C7NA 2E8AA 1NGJA 2MN5A 1L4VA 3FZLA 4HHFA 2YIOA 3KP1A 2D56A 1AYJA 1TI5A 2YC1C 2A7TA 3A8YA 3LDLA 2ASCA 1KV0A 5FPEA 1BK8A 5AQVA 5CY0A 1T0ZA 3FZFA 1ZU3A 2KBJA 3KOWA 2K35A 2VY6A 2QWMA 3D2EB 4AB0A 1I6GA 1WT7A 2KPYA 5F1XA 2LN8A 3QFUA 1PTXA 1SEGA 3FZMA 2KGQA 1NE5A 5FPMA 2QWNA 2KHOA 2GMOA 4KBOA 1B3CA 1GPSA 2QWRA 5BPLA 1BA1A 3KOYA 5EY4A 1BCGA 3PSMA 1NRBA 5F0XA 3KC6A 1VNBA 2M8BB 3L56A 1JZBA 4H5WA 1NGAA 5AQPA 4UADE 4V1DC 1BRZA 1I2VA 2LT8A 1PE4A 2MZ0A 3D2EA 1DKGD 2LJ7A 2NY8X 4FSVA 4H5TA 2E3FA 5AQHA 3QMLA 4GNIA 4UAFE 2QWQA 3E7RL 1C55A 2QXLA 1LQQA 3FZKA 3D2FB 3QFPA 1MR4A 4HE7A 2SN3A 2QWPA 1POIA 1NGGA 5AQWA 5AQKA 1BUPA 1ZYWA 1ATSA 5AQFA 1WMTA 4KYPA 5EX5A 3E7UX 1I6FA 1NGEA 1NGCA 2LY5A 1QQNA 3BK3C 2I61A 1ZYVA 4AEIA 1GPTA 1T7AA 2LY6A 3FZHA 1K8BA 2BRZA 3GDQA 2LJMA 2B3CA 1AHOA 5BN8A 1JKZA 2N66A 5AQIA 1I2UA 5BN9A 1B7DA 2E0HA 1P0AA 1ZVEA 3D2FA 4H5RA 5AQUA 3SF4D 1T7BA 1ICAA 3KOXA 2MBKA 1BA0A 2YBRC 4FL9A 5AQMA 5AQTA 1SN4A 5AQRA 1QQMA 2KBKA 3L6QA 3M3ZA 5BPNA 1KAXA 1JZAA 1HX1A 3ATVA 1T1TA 5FPNA 2LKBA 2YILA 1CHZA 5AQJA 2BUPA 5AQQA 1KAZA 3LDOA 3ATUA 1ZUTA 1NRAA
chains in the Genus database with same CATH topology
3FE1A 3KHWA 5AQXA 2JDQD 1S3XA 2QWOA 1HJOA 3R2VA 5BPMA 5AQNA 1NGIA 4H5VA 3IUCA 1YUWA 3JXUA 2V7ZA 3LDQA 2E2FA 5AQYA 3LDPA 1HPMA 1NGFA 4IO8A 3CQXA 3CW4A 5AQOA 5AQZA 5AQLA 4H5NA 2E88A 5AQGA 5AQSA 3KVGA 5F2RA 1KAYA 3C7NB 1NGBA 2QW9A 3QI7A 4HWIA 5EVZA 3GL1A 1NGDA 2QWLA 5FPDA 3LDNA 1QQOA 3L4IA 3AY9A 3I33A 1ATRA 3HSCA 4UAEF 5AR0A 1NGHA 5EXWA 2YIPA 3C7NA 2E8AA 1NGJA 2MN5A 3FZLA 2YIOA 2D56A 3A8YA 3LDLA 5FPEA 5AQVA 3FZFA 2K35A 2VY6A 2QWMA 3D2EB 5F1XA 2LN8A 3QFUA 3FZMA 5FPMA 2QWNA 2KHOA 2GMOA 4KBOA 2QWRA 5BPLA 1BA1A 5EY4A 5F0XA 3KC6A 3L56A 4H5WA 1NGAA 5AQPA 4UADE 3D2EA 1DKGD 4FSVA 4H5TA 5AQHA 3QMLA 4GNIA 4UAFE 2QWQA 2QXLA 3FZKA 3D2FB 3QFPA 2QWPA 1POIA 1NGGA 5AQWA 5AQKA 1BUPA 5AQFA 1ATSA 5EX5A 1NGEA 1NGCA 1QQNA 3BK3C 3FZHA 3GDQA 5BN8A 5AQIA 5BN9A 3D2FA 4H5RA 5AQUA 3SF4D 2MBKA 1BA0A 4FL9A 5AQMA 5AQTA 5AQRA 1QQMA 3L6QA 5BPNA 1KAXA 3ATVA 1HX1A 5FPNA 2YILA 5AQJA 2BUPA 5AQQA 1KAZA 3LDOA 3ATUA 3M3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHW A;  2JDQ D;  3KC6 A;  3L56 A;  3CW4 A;  2GMO A;  4UAE F;  2VY6 A;  4UAF E;  3R2V A;  4UAD E; 
#chains in the Genus database with same CATH topology
 1BMR A;  1DQ7 A;  3FE1 A;  3KHW A;  5AQX A;  3KP0 A;  2JDQ D;  1S3X A;  4UJ0 A;  2QWO A;  1HJO A;  2E3G A;  3R2V A;  1OZZ A;  5BPM A;  1T7E A;  2N2Q A;  5AQN A;  1NGI A;  4H5V A;  3IUC A;  4AAZ A;  2KYQ A;  1YUW A;  1LQI A;  1PX9 A;  3JXU A;  2V7Z A;  1JXC A;  3LDQ A;  1C56 A;  1N4N A;  2E2F A;  5AQY A;  1UGL A;  2GL1 A;  3LDP A;  1HPM A;  1NGF A;  1NH5 A;  1NPI A;  4IO8 A;  3CQX A;  1OMY A;  2NY9 X;  2LR3 A;  3CW4 A;  5AQO A;  5AQL A;  5AQZ A;  5KK4 A;  4H5N A;  2B68 A;  1WWN A;  2E88 A;  5AQG A;  5AQS A;  3KVG A;  5F2R A;  1KAY A;  2N2R A;  1CN2 A;  3C7N B;  2ATB A;  1NGB A;  1ZFU A;  2QW9 A;  1MYN A;  3QI7 A;  4HWI A;  5EVZ A;  2KJA A;  1NGD A;  2QWL A;  3GL1 A;  5FPD A;  2YEO A;  2KBH A;  2KSK A;  1VNA A;  3LDN A;  1P00 A;  1QQO A;  1XRS B;  2G2K A;  2LI7 A;  3AY9 A;  1ATR A;  1ZVG A;  3HSC A;  3I33 A;  3L4I A;  2N69 A;  4UAE F;  1FH3 A;  1LQH A;  3GKU A;  3KOZ A;  1SNB A;  5AR0 A;  4CQK A;  1NGH A;  5EXW A;  1DJT A;  1SN1 A;  2YIP A;  3C7N A;  2E8A A;  1NGJ A;  2MN5 A;  1L4V A;  3FZL A;  4HHF A;  2YIO A;  3KP1 A;  2D56 A;  1AYJ A;  1TI5 A;  2YC1 C;  2A7T A;  3A8Y A;  3LDL A;  2ASC A;  1KV0 A;  5FPE A;  1BK8 A;  5AQV A;  5CY0 A;  1T0Z A;  3FZF A;  1ZU3 A;  2KBJ A;  3KOW A;  2K35 A;  2VY6 A;  2QWM A;  3D2E B;  4AB0 A;  1I6G A;  1WT7 A;  2KPY A;  5F1X A;  2LN8 A;  3QFU A;  1PTX A;  1SEG A;  3FZM A;  2KGQ A;  1NE5 A;  5FPM A;  2QWN A;  2KHO A;  2GMO A;  4KBO A;  1B3C A;  1GPS A;  2QWR A;  5BPL A;  1BA1 A;  3KOY A;  5EY4 A;  1BCG A;  3PSM A;  1NRB A;  5F0X A;  3KC6 A;  1VNB A;  2M8B B;  3L56 A;  1JZB A;  4H5W A;  1NGA A;  5AQP A;  4UAD E;  4V1D C;  1BRZ A;  1I2V A;  2LT8 A;  1PE4 A;  2MZ0 A;  3D2E A;  1DKG D;  2LJ7 A;  2NY8 X;  4FSV A;  4H5T A;  2E3F A;  5AQH A;  3QML A;  4GNI A;  4UAF E;  2QWQ A;  3E7R L;  1C55 A;  2QXL A;  1LQQ A;  3FZK A;  3D2F B;  3QFP A;  1MR4 A;  4HE7 A;  2SN3 A;  2QWP A;  1POI A;  1NGG A;  5AQW A;  5AQK A;  1BUP A;  1ZYW A;  1ATS A;  5AQF A;  1WMT A;  4KYP A;  5EX5 A;  3E7U X;  1I6F A;  1NGE A;  1NGC A;  2LY5 A;  1QQN A;  3BK3 C;  2I61 A;  1ZYV A;  4AEI A;  1GPT A;  1T7A A;  2LY6 A;  3FZH A;  1K8B A;  2BRZ A;  3GDQ A;  2LJM A;  2B3C A;  1AHO A;  5BN8 A;  1JKZ A;  2N66 A;  5AQI A;  1I2U A;  5BN9 A;  1B7D A;  2E0H A;  1P0A A;  1ZVE A;  3D2F A;  4H5R A;  5AQU A;  3SF4 D;  1T7B A;  1ICA A;  3KOX A;  2MBK A;  1BA0 A;  2YBR C;  4FL9 A;  5AQM A;  5AQT A;  1SN4 A;  5AQR A;  1QQM A;  2KBK A;  3L6Q A;  3M3Z A;  5BPN A;  1KAX A;  1JZA A;  1HX1 A;  3ATV A;  1T1T A;  5FPN A;  2LKB A;  2YIL A;  1CHZ A;  5AQJ A;  2BUP A;  5AQQ A;  1KAZ A;  3LDO A;  3ATU A;  1ZUT A;  1NRA A; 
#chains in the Genus database with same CATH homology
 3FE1 A;  3KHW A;  5AQX A;  2JDQ D;  1S3X A;  2QWO A;  1HJO A;  3R2V A;  5BPM A;  5AQN A;  1NGI A;  4H5V A;  3IUC A;  1YUW A;  3JXU A;  2V7Z A;  3LDQ A;  2E2F A;  5AQY A;  3LDP A;  1HPM A;  1NGF A;  4IO8 A;  3CQX A;  3CW4 A;  5AQO A;  5AQZ A;  5AQL A;  4H5N A;  2E88 A;  5AQG A;  5AQS A;  3KVG A;  5F2R A;  1KAY A;  3C7N B;  1NGB A;  2QW9 A;  3QI7 A;  4HWI A;  5EVZ A;  3GL1 A;  1NGD A;  2QWL A;  5FPD A;  3LDN A;  1QQO A;  3L4I A;  3AY9 A;  3I33 A;  1ATR A;  3HSC A;  4UAE F;  5AR0 A;  1NGH A;  5EXW A;  2YIP A;  3C7N A;  2E8A A;  1NGJ A;  2MN5 A;  3FZL A;  2YIO A;  2D56 A;  3A8Y A;  3LDL A;  5FPE A;  5AQV A;  3FZF A;  2K35 A;  2VY6 A;  2QWM A;  3D2E B;  5F1X A;  2LN8 A;  3QFU A;  3FZM A;  5FPM A;  2QWN A;  2KHO A;  2GMO A;  4KBO A;  2QWR A;  5BPL A;  1BA1 A;  5EY4 A;  5F0X A;  3KC6 A;  3L56 A;  4H5W A;  1NGA A;  5AQP A;  4UAD E;  3D2E A;  1DKG D;  4FSV A;  4H5T A;  5AQH A;  3QML A;  4GNI A;  4UAF E;  2QWQ A;  2QXL A;  3FZK A;  3D2F B;  3QFP A;  2QWP A;  1POI A;  1NGG A;  5AQW A;  5AQK A;  1BUP A;  5AQF A;  1ATS A;  5EX5 A;  1NGE A;  1NGC A;  1QQN A;  3BK3 C;  3FZH A;  3GDQ A;  5BN8 A;  5AQI A;  5BN9 A;  3D2F A;  4H5R A;  5AQU A;  3SF4 D;  2MBK A;  1BA0 A;  4FL9 A;  5AQM A;  5AQT A;  5AQR A;  1QQM A;  3L6Q A;  5BPN A;  1KAX A;  3ATV A;  1HX1 A;  5FPN A;  2YIL A;  5AQJ A;  2BUP A;  5AQQ A;  1KAZ A;  3LDO A;  3ATU A;  3M3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...