4UADE

Importin alpha 7 delta ibb in complex with influenza pb2 nuclear localization domain
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
75
structure length
75
Chain Sequence
TSGVESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Importin subunit alpha-7
publication title Molecular Determinants for Nuclear Import of Influenza A PB2 by Importin alpha Isoforms 3 and 7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 13
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2014-08-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 4uadE00
3L56A 4UAFE 3KHWA 2JDQD 4UADE 2GMOA 2VY6A 3R2VA 3CW4A 3KC6A 4UAEF
chains in the Genus database with same CATH superfamily
3A8YA 3L56A 1MR4A 1NGAA 4UAFE 1B3CA 1T7BA 2KBKA 1SN4A 1N4NA 3C7NA 3CQXA 5BPNA 3QFUA 1HX1A 1FH3A 1I2VA 2E88A 2ATBA 2MN5A 5F0XA 2D56A 3GKUA 5AQIA 1BK8A 2KJAA 2ASCA 5AQRA 3LDQA 1BA0A 1K8BA 1PTXA 4AEIA 1OZZA 3PSMA 1C55A 4H5WA 3M3ZA 2LY5A 1TI5A 3JXUA 2QWLA 2A7TA 3LDOA 3KOXA 2GL1A 1QQNA 2I61A 2KBJA 3KHWA 4H5RA 2N66A 1PE4A 2QWRA 3ATVA 1DJTA 3CW4A 5KK4A 1GPSA 3KOZA 3E7UX 3IUCA 2KHOA 1P00A 2MBKA 1POIA 1WMTA 2BUPA 1I6FA 2KGQA 3R2VA 2E3FA 1BRZA 1JKZA 1C56A 4GNIA 3SF4D 1BA1A 2SN3A 1ICAA 1NGCA 4H5VA 5AQQA 1KAXA 1MYNA 2G2KA 1ZVEA 5AQYA 2KSKA 2M8BB 2YIOA 1ATRA 2E0HA 2LT8A 4KYPA 5F1XA 3LDPA 4FL9A 5BN8A 1L4VA 2QWOA 3HSCA 1ZYWA 5AQMA 1JZAA 2NY9X 1T1TA 2KBHA 3D2FB 3QFPA 3LDLA 3I33A 5AQLA 1NRAA 1I2UA 1LQIA 2B3CA 5AQJA 3KOYA 1SN1A 3BK3C 3LDNA 1JZBA 1WT7A 3KVGA 2N2QA 1GPTA 3FZLA 1BMRA 1ZYVA 1T0ZA 3GDQA 2YEOA 1KV0A 3KOWA 3D2EA 5AQKA 4H5TA 1KAYA 5FPNA 1UGLA 1T7AA 1OMYA 2QXLA 1T7EA 1HJOA 1NGBA 3FZKA 2LY6A 4AB0A 3FZMA 5AQZA 1ZUTA 2YILA 4HE7A 5FPDA 1NGFA 3E7RL 2MZ0A 5AQTA 5AQWA 1AHOA 1NE5A 3KP1A 3FE1A 2E3GA 1SEGA 1SNBA 5AQFA 3C7NB 1S3XA 2KPYA 4UAEF 4FSVA 1LQQA 1NRBA 1P0AA 1YUWA 2QWNA 2YIPA 5AQOA 5AQUA 1KAZA 2YC1C 3QI7A 2GMOA 5EVZA 1I6GA 1NGEA 2V7ZA 1PX9A 1BCGA 1NGJA 1VNBA 5AQNA 3FZHA 1JXCA 1NGHA 2VY6A 5EXWA 1QQOA 1NPIA 3L4IA 1DKGD 1DQ7A 1BUPA 2LI7A 4HWIA 1ZFUA 5FPMA 1ZVGA 3FZFA 1HPMA 2E8AA 2QWPA 2QWQA 1ATSA 2JDQD 3KP0A 4UADE 1LQHA 3D2EB 5BN9A 2QWMA 2QW9A 2K35A 3KC6A 5AR0A 1B7DA 5FPEA 5AQVA 5CY0A 2NY8X 3AY9A 1ZU3A 3D2FA 1NGDA 1QQMA 3ATUA 3GL1A 5AQXA 5EY4A 5F2RA 5BPLA 1AYJA 4KBOA 1NH5A 5EX5A 2N2RA 1CN2A 2LJ7A 4HHFA 1NGIA 1CHZA 4AAZA 4CQKA 1NGGA 1XRSB 2E2FA 1VNAA 2BRZA 5AQPA 5BPMA 2N69A 2LR3A 5AQSA 3QMLA 4UJ0A 2KYQA 2YBRC 5AQGA 2LJMA 4H5NA 2LKBA 2LN8A 3L6QA 4IO8A 4V1DC 5AQHA 2B68A 1WWNA
chains in the Genus database with same CATH topology
3A8YA 3L56A 1NGAA 4UAFE 5BPNA 3C7NA 3CQXA 3QFUA 1HX1A 2E88A 2MN5A 5F0XA 2D56A 5AQIA 5AQRA 3LDQA 1BA0A 4H5WA 3M3ZA 3JXUA 2QWLA 3LDOA 1QQNA 4H5RA 3KHWA 2QWRA 3ATVA 3CW4A 3IUCA 2KHOA 2MBKA 1POIA 2BUPA 3R2VA 4GNIA 3SF4D 1BA1A 1NGCA 4H5VA 5AQQA 1KAXA 5AQYA 2YIOA 1ATRA 5F1XA 3LDPA 4FL9A 5BN8A 2QWOA 3HSCA 5AQMA 3D2FB 3QFPA 3LDLA 3I33A 5AQLA 5AQJA 3BK3C 3LDNA 3KVGA 3FZLA 3GDQA 5AQKA 3D2EA 4H5TA 1KAYA 5FPNA 2QXLA 1HJOA 1NGBA 3FZKA 3FZMA 5AQZA 2YILA 5FPDA 1NGFA 5AQTA 5AQWA 3FE1A 5AQFA 3C7NB 1S3XA 4UAEF 4FSVA 1YUWA 2QWNA 2YIPA 5AQOA 5AQUA 1KAZA 3QI7A 5EVZA 2GMOA 1NGEA 2V7ZA 1NGJA 5AQNA 3FZHA 1NGHA 2VY6A 5EXWA 1QQOA 3L4IA 1DKGD 1BUPA 4HWIA 5FPMA 3FZFA 1HPMA 2E8AA 2QWPA 2QWQA 1ATSA 2JDQD 4UADE 3D2EB 5BN9A 2QWMA 2QW9A 2K35A 3KC6A 5AR0A 5FPEA 5AQVA 3AY9A 3D2FA 5AQXA 1NGDA 1QQMA 3ATUA 3GL1A 5EY4A 5F2RA 5BPLA 4KBOA 5EX5A 1NGIA 1NGGA 2E2FA 5AQPA 5BPMA 5AQSA 3QMLA 5AQGA 4H5NA 3L6QA 2LN8A 4IO8A 5AQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L56 A;  4UAF E;  3KHW A;  2JDQ D;  4UAD E;  2GMO A;  2VY6 A;  3R2V A;  3CW4 A;  3KC6 A;  4UAE F; 
#chains in the Genus database with same CATH topology
 3A8Y A;  3L56 A;  1MR4 A;  1NGA A;  4UAF E;  1B3C A;  1T7B A;  2KBK A;  1SN4 A;  1N4N A;  3C7N A;  3CQX A;  5BPN A;  3QFU A;  1HX1 A;  1FH3 A;  1I2V A;  2E88 A;  2ATB A;  2MN5 A;  5F0X A;  2D56 A;  3GKU A;  5AQI A;  1BK8 A;  2KJA A;  2ASC A;  5AQR A;  3LDQ A;  1BA0 A;  1K8B A;  1PTX A;  4AEI A;  1OZZ A;  3PSM A;  1C55 A;  4H5W A;  3M3Z A;  2LY5 A;  1TI5 A;  3JXU A;  2QWL A;  2A7T A;  3LDO A;  3KOX A;  2GL1 A;  1QQN A;  2I61 A;  2KBJ A;  3KHW A;  4H5R A;  2N66 A;  1PE4 A;  2QWR A;  3ATV A;  1DJT A;  3CW4 A;  5KK4 A;  1GPS A;  3KOZ A;  3E7U X;  3IUC A;  2KHO A;  1P00 A;  2MBK A;  1POI A;  1WMT A;  2BUP A;  1I6F A;  2KGQ A;  3R2V A;  2E3F A;  1BRZ A;  1JKZ A;  1C56 A;  4GNI A;  3SF4 D;  1BA1 A;  2SN3 A;  1ICA A;  1NGC A;  4H5V A;  5AQQ A;  1KAX A;  1MYN A;  2G2K A;  1ZVE A;  5AQY A;  2KSK A;  2M8B B;  2YIO A;  1ATR A;  2E0H A;  2LT8 A;  4KYP A;  5F1X A;  3LDP A;  4FL9 A;  5BN8 A;  1L4V A;  2QWO A;  3HSC A;  1ZYW A;  5AQM A;  1JZA A;  2NY9 X;  1T1T A;  2KBH A;  3D2F B;  3QFP A;  3LDL A;  3I33 A;  5AQL A;  1NRA A;  1I2U A;  1LQI A;  2B3C A;  5AQJ A;  3KOY A;  1SN1 A;  3BK3 C;  3LDN A;  1JZB A;  1WT7 A;  3KVG A;  2N2Q A;  1GPT A;  3FZL A;  1BMR A;  1ZYV A;  1T0Z A;  3GDQ A;  2YEO A;  1KV0 A;  3KOW A;  3D2E A;  5AQK A;  4H5T A;  1KAY A;  5FPN A;  1UGL A;  1T7A A;  1OMY A;  2QXL A;  1T7E A;  1HJO A;  1NGB A;  3FZK A;  2LY6 A;  4AB0 A;  3FZM A;  5AQZ A;  1ZUT A;  2YIL A;  4HE7 A;  5FPD A;  1NGF A;  3E7R L;  2MZ0 A;  5AQT A;  5AQW A;  1AHO A;  1NE5 A;  3KP1 A;  3FE1 A;  2E3G A;  1SEG A;  1SNB A;  5AQF A;  3C7N B;  1S3X A;  2KPY A;  4UAE F;  4FSV A;  1LQQ A;  1NRB A;  1P0A A;  1YUW A;  2QWN A;  2YIP A;  5AQO A;  5AQU A;  1KAZ A;  2YC1 C;  3QI7 A;  2GMO A;  5EVZ A;  1I6G A;  1NGE A;  2V7Z A;  1PX9 A;  1BCG A;  1NGJ A;  1VNB A;  5AQN A;  3FZH A;  1JXC A;  1NGH A;  2VY6 A;  5EXW A;  1QQO A;  1NPI A;  3L4I A;  1DKG D;  1DQ7 A;  1BUP A;  2LI7 A;  4HWI A;  1ZFU A;  5FPM A;  1ZVG A;  3FZF A;  1HPM A;  2E8A A;  2QWP A;  2QWQ A;  1ATS A;  2JDQ D;  3KP0 A;  4UAD E;  1LQH A;  3D2E B;  5BN9 A;  2QWM A;  2QW9 A;  2K35 A;  3KC6 A;  5AR0 A;  1B7D A;  5FPE A;  5AQV A;  5CY0 A;  2NY8 X;  3AY9 A;  1ZU3 A;  3D2F A;  1NGD A;  1QQM A;  3ATU A;  3GL1 A;  5AQX A;  5EY4 A;  5F2R A;  5BPL A;  1AYJ A;  4KBO A;  1NH5 A;  5EX5 A;  2N2R A;  1CN2 A;  2LJ7 A;  4HHF A;  1NGI A;  1CHZ A;  4AAZ A;  4CQK A;  1NGG A;  1XRS B;  2E2F A;  1VNA A;  2BRZ A;  5AQP A;  5BPM A;  2N69 A;  2LR3 A;  5AQS A;  3QML A;  4UJ0 A;  2KYQ A;  2YBR C;  5AQG A;  2LJM A;  4H5N A;  2LKB A;  2LN8 A;  3L6Q A;  4IO8 A;  4V1D C;  5AQH A;  2B68 A;  1WWN A; 
#chains in the Genus database with same CATH homology
 3A8Y A;  3L56 A;  1NGA A;  4UAF E;  5BPN A;  3C7N A;  3CQX A;  3QFU A;  1HX1 A;  2E88 A;  2MN5 A;  5F0X A;  2D56 A;  5AQI A;  5AQR A;  3LDQ A;  1BA0 A;  4H5W A;  3M3Z A;  3JXU A;  2QWL A;  3LDO A;  1QQN A;  4H5R A;  3KHW A;  2QWR A;  3ATV A;  3CW4 A;  3IUC A;  2KHO A;  2MBK A;  1POI A;  2BUP A;  3R2V A;  4GNI A;  3SF4 D;  1BA1 A;  1NGC A;  4H5V A;  5AQQ A;  1KAX A;  5AQY A;  2YIO A;  1ATR A;  5F1X A;  3LDP A;  4FL9 A;  5BN8 A;  2QWO A;  3HSC A;  5AQM A;  3D2F B;  3QFP A;  3LDL A;  3I33 A;  5AQL A;  5AQJ A;  3BK3 C;  3LDN A;  3KVG A;  3FZL A;  3GDQ A;  5AQK A;  3D2E A;  4H5T A;  1KAY A;  5FPN A;  2QXL A;  1HJO A;  1NGB A;  3FZK A;  3FZM A;  5AQZ A;  2YIL A;  5FPD A;  1NGF A;  5AQT A;  5AQW A;  3FE1 A;  5AQF A;  3C7N B;  1S3X A;  4UAE F;  4FSV A;  1YUW A;  2QWN A;  2YIP A;  5AQO A;  5AQU A;  1KAZ A;  3QI7 A;  5EVZ A;  2GMO A;  1NGE A;  2V7Z A;  1NGJ A;  5AQN A;  3FZH A;  1NGH A;  2VY6 A;  5EXW A;  1QQO A;  3L4I A;  1DKG D;  1BUP A;  4HWI A;  5FPM A;  3FZF A;  1HPM A;  2E8A A;  2QWP A;  2QWQ A;  1ATS A;  2JDQ D;  4UAD E;  3D2E B;  5BN9 A;  2QWM A;  2QW9 A;  2K35 A;  3KC6 A;  5AR0 A;  5FPE A;  5AQV A;  3AY9 A;  3D2F A;  5AQX A;  1NGD A;  1QQM A;  3ATU A;  3GL1 A;  5EY4 A;  5F2R A;  5BPL A;  4KBO A;  5EX5 A;  1NGI A;  1NGG A;  2E2F A;  5AQP A;  5BPM A;  5AQS A;  3QML A;  5AQG A;  4H5N A;  3L6Q A;  2LN8 A;  4IO8 A;  5AQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...