2YBRC

Crystal structure of the human derived single chain antibody fragment (scfv) 9004g in complex with cn2 toxin from the scorpion centruroides noxius hoffmann
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
b'KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINGLE CHAIN ANTIBODY FRAGMENT 9004G
publication title Structural Basis of Neutralization of the Major Toxic Component from the Scorpion Centruroides Noxius Hoffmann by a Human-Derived Single Chain Antibody Fragment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/toxin
total genus 15
structure length 65
sequence length 65
chains with identical sequence F, I
ec nomenclature
pdb deposition date 2011-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2ybrC00
1SN1A 2I61A 1NRBA 1MR4A 1ZU3A 2KPYA 1ZFUA 1T1TA 2MZ0A 2KJAA 1KV0A 1I2UA 1BMRA 2KSKA 2N66A 1DJTA 1LQQA 4KYPA 1T7BA 2BRZA 1I2VA 1LQHA 2LJMA 2SN3A 2LY6A 1C56A 2B68A 1OMYA 1ZYVA 1I6FA 1CHZA 1BK8A 1BCGA 1SN4A 1ZUTA 1NRAA 4AEIA 1N4NA 1NH5A 1JKZA 1L4VA 2KBHA 4V1DC 1AHOA 4AAZA 1DQ7A 1P0AA 2LR3A 1NE5A 1JZBA 1T7AA 1JXCA 2KYQA 1PE4A 2LI7A 1TI5A 1PX9A 1ICAA 1NPIA 3E7UX 4CQKA 1BRZA 2LKBA 1B7DA 2N2RA 1VNAA 2ASCA 2NY9X 1LQIA 2E3GA 2M8BB 1AYJA 2KGQA 1JZAA 1C55A 5CY0A 2NY8X 4HHFA 1GPSA 2GL1A 1WT7A 2N69A 4HE7A 2KBKA 1T7EA 1SEGA 1FH3A 5KK4A 2ATBA 1I6GA 1B3CA 1T0ZA 1P00A 1ZVEA 3PSMA 1SNBA 2YBRC 1WWNA 2E0HA 2LT8A 1WMTA 2YEOA 1ZVGA 2A7TA 2LJ7A 3E7RL 2LY5A 1OZZA 1MYNA 2N2QA 2YC1C 1VNBA 2KBJA 1CN2A 1GPTA 2E3FA 4AB0A 4UJ0A 1PTXA 1ZYWA 2B3CA
chains in the Genus database with same CATH superfamily
2YIPA 3FZFA 3KP0A 1SN1A 4UAFE 2I61A 2GMOA 1DKGD 5EVZA 1NRBA 1UGLA 1MR4A 3KOWA 1ZU3A 2QWPA 2KPYA 3CW4A 3LDNA 1ZFUA 4UADE 1T1TA 1KAXA 2MZ0A 2KJAA 4UAEF 1KV0A 3ATVA 3KP1A 1I2UA 4KBOA 1K8BA 3FZHA 1BMRA 3D2EA 3D2FB 2KSKA 3D2EB 2N66A 1DJTA 1HPMA 1LQQA 5AQZA 1BA1A 4KYPA 1ATRA 3JXUA 1T7BA 2BRZA 5AQSA 1LQHA 2LJMA 2SN3A 1I2VA 2LY6A 1C56A 2B68A 2V7ZA 1OMYA 2MN5A 1ZYVA 3FZKA 3L4IA 3QFPA 5FPEA 5AQLA 1NGEA 1S3XA 5AQNA 5AQWA 5BN8A 4FL9A 1I6FA 5AQIA 5BPMA 2KHOA 1CHZA 1BK8A 1BCGA 5AQYA 3QFUA 5AQFA 5EXWA 1SN4A 1NGCA 1ZUTA 1NRAA 5EY4A 4H5NA 4AEIA 1N4NA 1NH5A 4GNIA 5AQRA 1JKZA 1L4VA 2KBHA 4V1DC 2QWLA 1AHOA 4AAZA 3I33A 1BUPA 5F2RA 1DQ7A 5AQTA 1P0AA 1NGDA 3KVGA 5AQMA 5AQXA 2QWOA 1NGAA 3D2FA 2LR3A 1JZBA 1NE5A 1T7AA 2E8AA 3LDLA 3QI7A 3KOYA 4HWIA 5AQGA 2E2FA 5BN9A 1QQNA 1JXCA 2KYQA 1PE4A 1XRSB 5AQVA 2LI7A 5F1XA 1TI5A 1PX9A 1ICAA 1NPIA 3GDQA 3E7UX 4CQKA 1BRZA 2LKBA 1KAZA 3IUCA 1B7DA 2N2RA 1VNAA 3LDPA 2ASCA 4H5WA 5FPNA 2NY9X 1KAYA 2LN8A 3M3ZA 1LQIA 4H5VA 3GKUA 5AQPA 3FE1A 3QMLA 1NGGA 2E3GA 2M8BB 1AYJA 1NGIA 2KGQA 1JZAA 5BPLA 2BUPA 1C55A 3A8YA 5CY0A 1NGFA 1BA0A 2D56A 1ATSA 2NY8X 3KHWA 5AR0A 1HJOA 4HHFA 1GPSA 2GL1A 1WT7A 2N69A 3KOZA 1QQMA 3FZMA 3LDQA 1HX1A 2KBKA 3L6QA 4HE7A 1T7EA 2JDQD 3CQXA 1NGJA 5AQQA 1SEGA 3SF4D 5KK4A 1FH3A 2ATBA 3KOXA 3ATUA 5FPDA 3C7NB 2MBKA 1I6GA 5AQJA 3L56A 1B3CA 1T0ZA 1P00A 2QXLA 1ZVEA 3PSMA 5AQUA 1SNBA 4H5TA 3AY9A 2E88A 2QWQA 2YBRC 1WWNA 2K35A 2E0HA 2LT8A 3FZLA 3R2VA 1WMTA 5F0XA 5AQHA 4IO8A 5BPNA 2YEOA 1ZVGA 2G2KA 5AQOA 2A7TA 2QW9A 3GL1A 4H5RA 2LJ7A 1POIA 1QQOA 3E7RL 2LY5A 1OZZA 2VY6A 2YIOA 1MYNA 2N2QA 2QWRA 2YC1C 1VNBA 3BK3C 2QWNA 5FPMA 4FSVA 1YUWA 2KBJA 2QWMA 1CN2A 1GPTA 2E3FA 5AQKA 1NGBA 3HSCA 3KC6A 3C7NA 5EX5A 1NGHA 2YILA 4AB0A 4UJ0A 1PTXA 1ZYWA 3LDOA 2B3CA
chains in the Genus database with same CATH topology
1SN1A 2I61A 1NRBA 1MR4A 1ZU3A 2KPYA 1ZFUA 1T1TA 2MZ0A 2KJAA 1KV0A 1I2UA 1BMRA 2KSKA 2N66A 1DJTA 1LQQA 4KYPA 1T7BA 2BRZA 1I2VA 1LQHA 2LJMA 2SN3A 2LY6A 1C56A 2B68A 1OMYA 1ZYVA 1I6FA 1CHZA 1BK8A 1BCGA 1SN4A 1ZUTA 1NRAA 4AEIA 1N4NA 1NH5A 1JKZA 1L4VA 2KBHA 4V1DC 1AHOA 4AAZA 1DQ7A 1P0AA 2LR3A 1NE5A 1JZBA 1T7AA 1JXCA 2KYQA 1PE4A 2LI7A 1TI5A 1PX9A 1ICAA 1NPIA 3E7UX 4CQKA 1BRZA 2LKBA 1B7DA 2N2RA 1VNAA 2ASCA 2NY9X 1LQIA 2E3GA 2M8BB 1AYJA 2KGQA 1JZAA 1C55A 5CY0A 2NY8X 4HHFA 1GPSA 2GL1A 1WT7A 2N69A 4HE7A 2KBKA 1T7EA 1SEGA 1FH3A 5KK4A 2ATBA 1I6GA 1B3CA 1T0ZA 1P00A 1ZVEA 3PSMA 1SNBA 2YBRC 1WWNA 2E0HA 2LT8A 1WMTA 2YEOA 1ZVGA 2A7TA 2LJ7A 3E7RL 2LY5A 1OZZA 1MYNA 2N2QA 2YC1C 1VNBA 2KBJA 1CN2A 1GPTA 2E3FA 4AB0A 4UJ0A 1PTXA 1ZYWA 2B3CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SN1 A;  2I61 A;  1NRB A;  1MR4 A;  1ZU3 A;  2KPY A;  1ZFU A;  1T1T A;  2MZ0 A;  2KJA A;  1KV0 A;  1I2U A;  1BMR A;  2KSK A;  2N66 A;  1DJT A;  1LQQ A;  4KYP A;  1T7B A;  2BRZ A;  1I2V A;  1LQH A;  2LJM A;  2SN3 A;  2LY6 A;  1C56 A;  2B68 A;  1OMY A;  1ZYV A;  1I6F A;  1CHZ A;  1BK8 A;  1BCG A;  1SN4 A;  1ZUT A;  1NRA A;  4AEI A;  1N4N A;  1NH5 A;  1JKZ A;  1L4V A;  2KBH A;  4V1D C;  1AHO A;  4AAZ A;  1DQ7 A;  1P0A A;  2LR3 A;  1NE5 A;  1JZB A;  1T7A A;  1JXC A;  2KYQ A;  1PE4 A;  2LI7 A;  1TI5 A;  1PX9 A;  1ICA A;  1NPI A;  3E7U X;  4CQK A;  1BRZ A;  2LKB A;  1B7D A;  2N2R A;  1VNA A;  2ASC A;  2NY9 X;  1LQI A;  2E3G A;  2M8B B;  1AYJ A;  2KGQ A;  1JZA A;  1C55 A;  5CY0 A;  2NY8 X;  4HHF A;  1GPS A;  2GL1 A;  1WT7 A;  2N69 A;  4HE7 A;  2KBK A;  1T7E A;  1SEG A;  1FH3 A;  5KK4 A;  2ATB A;  1I6G A;  1B3C A;  1T0Z A;  1P00 A;  1ZVE A;  3PSM A;  1SNB A;  2YBR C;  1WWN A;  2E0H A;  2LT8 A;  1WMT A;  2YEO A;  1ZVG A;  2A7T A;  2LJ7 A;  3E7R L;  2LY5 A;  1OZZ A;  1MYN A;  2N2Q A;  2YC1 C;  1VNB A;  2KBJ A;  1CN2 A;  1GPT A;  2E3F A;  4AB0 A;  4UJ0 A;  1PTX A;  1ZYW A;  2B3C A; 
#chains in the Genus database with same CATH topology
 2YIP A;  3FZF A;  3KP0 A;  1SN1 A;  4UAF E;  2I61 A;  2GMO A;  1DKG D;  5EVZ A;  1NRB A;  1UGL A;  1MR4 A;  3KOW A;  1ZU3 A;  2QWP A;  2KPY A;  3CW4 A;  3LDN A;  1ZFU A;  4UAD E;  1T1T A;  1KAX A;  2MZ0 A;  2KJA A;  4UAE F;  1KV0 A;  3ATV A;  3KP1 A;  1I2U A;  4KBO A;  1K8B A;  3FZH A;  1BMR A;  3D2E A;  3D2F B;  2KSK A;  3D2E B;  2N66 A;  1DJT A;  1HPM A;  1LQQ A;  5AQZ A;  1BA1 A;  4KYP A;  1ATR A;  3JXU A;  1T7B A;  2BRZ A;  5AQS A;  1LQH A;  2LJM A;  2SN3 A;  1I2V A;  2LY6 A;  1C56 A;  2B68 A;  2V7Z A;  1OMY A;  2MN5 A;  1ZYV A;  3FZK A;  3L4I A;  3QFP A;  5FPE A;  5AQL A;  1NGE A;  1S3X A;  5AQN A;  5AQW A;  5BN8 A;  4FL9 A;  1I6F A;  5AQI A;  5BPM A;  2KHO A;  1CHZ A;  1BK8 A;  1BCG A;  5AQY A;  3QFU A;  5AQF A;  5EXW A;  1SN4 A;  1NGC A;  1ZUT A;  1NRA A;  5EY4 A;  4H5N A;  4AEI A;  1N4N A;  1NH5 A;  4GNI A;  5AQR A;  1JKZ A;  1L4V A;  2KBH A;  4V1D C;  2QWL A;  1AHO A;  4AAZ A;  3I33 A;  1BUP A;  5F2R A;  1DQ7 A;  5AQT A;  1P0A A;  1NGD A;  3KVG A;  5AQM A;  5AQX A;  2QWO A;  1NGA A;  3D2F A;  2LR3 A;  1JZB A;  1NE5 A;  1T7A A;  2E8A A;  3LDL A;  3QI7 A;  3KOY A;  4HWI A;  5AQG A;  2E2F A;  5BN9 A;  1QQN A;  1JXC A;  2KYQ A;  1PE4 A;  1XRS B;  5AQV A;  2LI7 A;  5F1X A;  1TI5 A;  1PX9 A;  1ICA A;  1NPI A;  3GDQ A;  3E7U X;  4CQK A;  1BRZ A;  2LKB A;  1KAZ A;  3IUC A;  1B7D A;  2N2R A;  1VNA A;  3LDP A;  2ASC A;  4H5W A;  5FPN A;  2NY9 X;  1KAY A;  2LN8 A;  3M3Z A;  1LQI A;  4H5V A;  3GKU A;  5AQP A;  3FE1 A;  3QML A;  1NGG A;  2E3G A;  2M8B B;  1AYJ A;  1NGI A;  2KGQ A;  1JZA A;  5BPL A;  2BUP A;  1C55 A;  3A8Y A;  5CY0 A;  1NGF A;  1BA0 A;  2D56 A;  1ATS A;  2NY8 X;  3KHW A;  5AR0 A;  1HJO A;  4HHF A;  1GPS A;  2GL1 A;  1WT7 A;  2N69 A;  3KOZ A;  1QQM A;  3FZM A;  3LDQ A;  1HX1 A;  2KBK A;  3L6Q A;  4HE7 A;  1T7E A;  2JDQ D;  3CQX A;  1NGJ A;  5AQQ A;  1SEG A;  3SF4 D;  5KK4 A;  1FH3 A;  2ATB A;  3KOX A;  3ATU A;  5FPD A;  3C7N B;  2MBK A;  1I6G A;  5AQJ A;  3L56 A;  1B3C A;  1T0Z A;  1P00 A;  2QXL A;  1ZVE A;  3PSM A;  5AQU A;  1SNB A;  4H5T A;  3AY9 A;  2E88 A;  2QWQ A;  2YBR C;  1WWN A;  2K35 A;  2E0H A;  2LT8 A;  3FZL A;  3R2V A;  1WMT A;  5F0X A;  5AQH A;  4IO8 A;  5BPN A;  2YEO A;  1ZVG A;  2G2K A;  5AQO A;  2A7T A;  2QW9 A;  3GL1 A;  4H5R A;  2LJ7 A;  1POI A;  1QQO A;  3E7R L;  2LY5 A;  1OZZ A;  2VY6 A;  2YIO A;  1MYN A;  2N2Q A;  2QWR A;  2YC1 C;  1VNB A;  3BK3 C;  2QWN A;  5FPM A;  4FSV A;  1YUW A;  2KBJ A;  2QWM A;  1CN2 A;  1GPT A;  2E3F A;  5AQK A;  1NGB A;  3HSC A;  3KC6 A;  3C7N A;  5EX5 A;  1NGH A;  2YIL A;  4AB0 A;  4UJ0 A;  1PTX A;  1ZYW A;  3LDO A;  2B3C A; 
#chains in the Genus database with same CATH homology
 1SN1 A;  2I61 A;  1NRB A;  1MR4 A;  1ZU3 A;  2KPY A;  1ZFU A;  1T1T A;  2MZ0 A;  2KJA A;  1KV0 A;  1I2U A;  1BMR A;  2KSK A;  2N66 A;  1DJT A;  1LQQ A;  4KYP A;  1T7B A;  2BRZ A;  1I2V A;  1LQH A;  2LJM A;  2SN3 A;  2LY6 A;  1C56 A;  2B68 A;  1OMY A;  1ZYV A;  1I6F A;  1CHZ A;  1BK8 A;  1BCG A;  1SN4 A;  1ZUT A;  1NRA A;  4AEI A;  1N4N A;  1NH5 A;  1JKZ A;  1L4V A;  2KBH A;  4V1D C;  1AHO A;  4AAZ A;  1DQ7 A;  1P0A A;  2LR3 A;  1NE5 A;  1JZB A;  1T7A A;  1JXC A;  2KYQ A;  1PE4 A;  2LI7 A;  1TI5 A;  1PX9 A;  1ICA A;  1NPI A;  3E7U X;  4CQK A;  1BRZ A;  2LKB A;  1B7D A;  2N2R A;  1VNA A;  2ASC A;  2NY9 X;  1LQI A;  2E3G A;  2M8B B;  1AYJ A;  2KGQ A;  1JZA A;  1C55 A;  5CY0 A;  2NY8 X;  4HHF A;  1GPS A;  2GL1 A;  1WT7 A;  2N69 A;  4HE7 A;  2KBK A;  1T7E A;  1SEG A;  1FH3 A;  5KK4 A;  2ATB A;  1I6G A;  1B3C A;  1T0Z A;  1P00 A;  1ZVE A;  3PSM A;  1SNB A;  2YBR C;  1WWN A;  2E0H A;  2LT8 A;  1WMT A;  2YEO A;  1ZVG A;  2A7T A;  2LJ7 A;  3E7R L;  2LY5 A;  1OZZ A;  1MYN A;  2N2Q A;  2YC1 C;  1VNB A;  2KBJ A;  1CN2 A;  1GPT A;  2E3F A;  4AB0 A;  4UJ0 A;  1PTX A;  1ZYW A;  2B3C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...