2KBJA

Solution structure of bmkalphatx11 (minor conformation)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
66
structure length
66
Chain Sequence
VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCYKLPDDARIMKPGRCNGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Toxin Bmka2
publication title Solution structure of BmKalphaTx11, a toxin from the venom of the Chinese scorpion Buthus martensii Karsch
pubmed doi rcsb
total genus 9
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2kbjA00
2M8BB 1I6GA 1PE4A 4AAZA 1T7EA 2ATBA 1OMYA 1CHZA 1B3CA 2A7TA 5KK4A 2LR3A 4V1DC 4HE7A 1SEGA 2NY8X 1LQIA 1T7BA 2LJMA 1C55A 1SNBA 2B68A 2YC1C 1GPTA 1I2UA 1PTXA 2I61A 1ICAA 2LKBA 2MZ0A 1ZVEA 4HHFA 1NH5A 1NRAA 2LY5A 5CY0A 1BCGA 1MYNA 2N2RA 1DJTA 2B3CA 1BRZA 1ZFUA 1JZBA 1NE5A 1SN1A 2KPYA 4UJ0A 1VNBA 1KV0A 1ZVGA 2LT8A 2E3FA 1NPIA 2KSKA 1P0AA 2E3GA 2KGQA 2LJ7A 1LQHA 4KYPA 2KBKA 2LY6A 1BMRA 1BK8A 2ASCA 3E7RL 1L4VA 1ZUTA 1CN2A 1JXCA 1TI5A 1ZU3A 1GPSA 1ZYWA 1VNAA 3E7UX 2BRZA 4AB0A 1ZYVA 2KBJA 2GL1A 2SN3A 2E0HA 2KYQA 1AHOA 1NRBA 1MR4A 2N69A 1JKZA 1T1TA 1LQQA 1C56A 1PX9A 4AEIA 2N2QA 1WT7A 1I2VA 2YBRC 1DQ7A 1B7DA 1N4NA 2LI7A 3PSMA 1SN4A 1T0ZA 2KBHA 2N66A 1JZAA 2NY9X 1P00A 1OZZA 1WWNA 4CQKA 1AYJA 1I6FA 2YEOA 1WMTA 2KJAA 1FH3A 1T7AA
chains in the Genus database with same CATH superfamily
3LDOA 2M8BB 1I6GA 5AQYA 1NGBA 3SF4D 5AQPA 1PE4A 5AQJA 2MBKA 4AAZA 3HSCA 4H5TA 1T7EA 2ATBA 1NGFA 1K8BA 2YIOA 5AQXA 5AQOA 1OMYA 2QWQA 4FSVA 1BA1A 1CHZA 2A7TA 4H5NA 5KK4A 1B3CA 3FE1A 2LR3A 4V1DC 4FL9A 1POIA 4HE7A 5F2RA 1SEGA 2NY8X 1LQIA 1T7BA 3GKUA 5AQNA 2LJMA 3GDQA 3FZMA 4KBOA 1BUPA 5EVZA 2MN5A 5EY4A 3FZHA 1C55A 2QWOA 5AQQA 1HPMA 1SNBA 5F1XA 5AQIA 3BK3C 1NGEA 2B68A 2YC1C 2BUPA 3CQXA 1GPTA 1YUWA 5AQLA 1I2UA 1PTXA 2I61A 2D56A 2LKBA 4H5WA 1QQNA 1ZVEA 2MZ0A 3L56A 1ICAA 3LDNA 4HHFA 1NH5A 1NRAA 2E2FA 2LY5A 3ATUA 3D2EA 1BCGA 3KOYA 3KHWA 5CY0A 1MYNA 2GMOA 2N2RA 1DJTA 2B3CA 5FPNA 1BRZA 5AQFA 1ZFUA 1JZBA 1NE5A 3ATVA 1SN1A 2KPYA 1ATRA 4UJ0A 3L4IA 1VNBA 3FZFA 1KV0A 5AQUA 5AQZA 3QFUA 3KP1A 1ZVGA 2LT8A 2V7ZA 5BN9A 2QWPA 3LDQA 1NGGA 2E3FA 4H5RA 1NPIA 1UGLA 1ATSA 1P0AA 2E3GA 2KSKA 3D2EB 3D2FB 3GL1A 2KGQA 2LJ7A 5BN8A 1NGJA 1BA0A 5F0XA 5AQWA 5AQRA 3LDPA 3IUCA 5AQVA 1LQHA 1NGHA 5FPEA 4KYPA 2KBKA 5AQKA 3KVGA 2QWLA 2LY6A 1BMRA 4GNIA 5AQGA 5FPDA 1NGDA 3KOZA 1BK8A 2E8AA 2ASCA 2QWRA 3E7RL 3QFPA 1L4VA 1NGIA 2JDQD 3D2FA 2QXLA 1ZUTA 1CN2A 1JXCA 3I33A 2QWMA 4H5VA 1KAZA 1TI5A 1ZU3A 2VY6A 3R2VA 4IO8A 5BPNA 1GPSA 1ZYWA 1HX1A 4HWIA 1VNAA 3E7UX 3A8YA 5AQHA 2BRZA 4AB0A 2G2KA 1ZYVA 2KBJA 3CW4A 2GL1A 1XRSB 2SN3A 3LDLA 2E0HA 2KYQA 5EX5A 3C7NB 1AHOA 2YILA 1NRBA 3M3ZA 4UADE 2E88A 5AQSA 3FZKA 1MR4A 1HJOA 1KAXA 2N69A 1JKZA 1T1TA 5FPMA 1LQQA 3KC6A 5AQTA 4UAEF 1C56A 1PX9A 3QMLA 2N2QA 4AEIA 2LN8A 1WT7A 3JXUA 3KOWA 2YIPA 5BPMA 1I2VA 2YBRC 1DQ7A 1B7DA 1N4NA 2LI7A 3PSMA 1S3XA 1SN4A 3C7NA 1NGAA 2QW9A 1DKGD 1T0ZA 2KBHA 2N66A 1JZAA 2NY9X 1P00A 1OZZA 3FZLA 5AQMA 1QQMA 3KOXA 4UAFE 1QQOA 5EXWA 1WWNA 2KHOA 3QI7A 3KP0A 4CQKA 5BPLA 1AYJA 1NGCA 1I6FA 3L6QA 2YEOA 1WMTA 2QWNA 2K35A 2KJAA 1FH3A 3AY9A 1T7AA 1KAYA 5AR0A
chains in the Genus database with same CATH topology
2M8BB 1I6GA 1PE4A 4AAZA 1T7EA 2ATBA 1OMYA 1CHZA 1B3CA 2A7TA 5KK4A 2LR3A 4V1DC 4HE7A 1SEGA 2NY8X 1LQIA 1T7BA 2LJMA 1C55A 1SNBA 2B68A 2YC1C 1GPTA 1I2UA 1PTXA 2I61A 1ICAA 2LKBA 2MZ0A 1ZVEA 4HHFA 1NH5A 1NRAA 2LY5A 5CY0A 1BCGA 1MYNA 2N2RA 1DJTA 2B3CA 1BRZA 1ZFUA 1JZBA 1NE5A 1SN1A 2KPYA 4UJ0A 1VNBA 1KV0A 1ZVGA 2LT8A 2E3FA 1NPIA 2KSKA 1P0AA 2E3GA 2KGQA 2LJ7A 1LQHA 4KYPA 2KBKA 2LY6A 1BMRA 1BK8A 2ASCA 3E7RL 1L4VA 1ZUTA 1CN2A 1JXCA 1TI5A 1ZU3A 1GPSA 1ZYWA 1VNAA 3E7UX 2BRZA 4AB0A 1ZYVA 2KBJA 2GL1A 2SN3A 2E0HA 2KYQA 1AHOA 1NRBA 1MR4A 2N69A 1JKZA 1T1TA 1LQQA 1C56A 1PX9A 4AEIA 2N2QA 1WT7A 1I2VA 2YBRC 1DQ7A 1B7DA 1N4NA 2LI7A 3PSMA 1SN4A 1T0ZA 2KBHA 2N66A 1JZAA 2NY9X 1P00A 1OZZA 1WWNA 4CQKA 1AYJA 1I6FA 2YEOA 1WMTA 2KJAA 1FH3A 1T7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8B B;  1I6G A;  1PE4 A;  4AAZ A;  1T7E A;  2ATB A;  1OMY A;  1CHZ A;  1B3C A;  2A7T A;  5KK4 A;  2LR3 A;  4V1D C;  4HE7 A;  1SEG A;  2NY8 X;  1LQI A;  1T7B A;  2LJM A;  1C55 A;  1SNB A;  2B68 A;  2YC1 C;  1GPT A;  1I2U A;  1PTX A;  2I61 A;  1ICA A;  2LKB A;  2MZ0 A;  1ZVE A;  4HHF A;  1NH5 A;  1NRA A;  2LY5 A;  5CY0 A;  1BCG A;  1MYN A;  2N2R A;  1DJT A;  2B3C A;  1BRZ A;  1ZFU A;  1JZB A;  1NE5 A;  1SN1 A;  2KPY A;  4UJ0 A;  1VNB A;  1KV0 A;  1ZVG A;  2LT8 A;  2E3F A;  1NPI A;  2KSK A;  1P0A A;  2E3G A;  2KGQ A;  2LJ7 A;  1LQH A;  4KYP A;  2KBK A;  2LY6 A;  1BMR A;  1BK8 A;  2ASC A;  3E7R L;  1L4V A;  1ZUT A;  1CN2 A;  1JXC A;  1TI5 A;  1ZU3 A;  1GPS A;  1ZYW A;  1VNA A;  3E7U X;  2BRZ A;  4AB0 A;  1ZYV A;  2KBJ A;  2GL1 A;  2SN3 A;  2E0H A;  2KYQ A;  1AHO A;  1NRB A;  1MR4 A;  2N69 A;  1JKZ A;  1T1T A;  1LQQ A;  1C56 A;  1PX9 A;  4AEI A;  2N2Q A;  1WT7 A;  1I2V A;  2YBR C;  1DQ7 A;  1B7D A;  1N4N A;  2LI7 A;  3PSM A;  1SN4 A;  1T0Z A;  2KBH A;  2N66 A;  1JZA A;  2NY9 X;  1P00 A;  1OZZ A;  1WWN A;  4CQK A;  1AYJ A;  1I6F A;  2YEO A;  1WMT A;  2KJA A;  1FH3 A;  1T7A A; 
#chains in the Genus database with same CATH topology
 3LDO A;  2M8B B;  1I6G A;  5AQY A;  1NGB A;  3SF4 D;  5AQP A;  1PE4 A;  5AQJ A;  2MBK A;  4AAZ A;  3HSC A;  4H5T A;  1T7E A;  2ATB A;  1NGF A;  1K8B A;  2YIO A;  5AQX A;  5AQO A;  1OMY A;  2QWQ A;  4FSV A;  1BA1 A;  1CHZ A;  2A7T A;  4H5N A;  5KK4 A;  1B3C A;  3FE1 A;  2LR3 A;  4V1D C;  4FL9 A;  1POI A;  4HE7 A;  5F2R A;  1SEG A;  2NY8 X;  1LQI A;  1T7B A;  3GKU A;  5AQN A;  2LJM A;  3GDQ A;  3FZM A;  4KBO A;  1BUP A;  5EVZ A;  2MN5 A;  5EY4 A;  3FZH A;  1C55 A;  2QWO A;  5AQQ A;  1HPM A;  1SNB A;  5F1X A;  5AQI A;  3BK3 C;  1NGE A;  2B68 A;  2YC1 C;  2BUP A;  3CQX A;  1GPT A;  1YUW A;  5AQL A;  1I2U A;  1PTX A;  2I61 A;  2D56 A;  2LKB A;  4H5W A;  1QQN A;  1ZVE A;  2MZ0 A;  3L56 A;  1ICA A;  3LDN A;  4HHF A;  1NH5 A;  1NRA A;  2E2F A;  2LY5 A;  3ATU A;  3D2E A;  1BCG A;  3KOY A;  3KHW A;  5CY0 A;  1MYN A;  2GMO A;  2N2R A;  1DJT A;  2B3C A;  5FPN A;  1BRZ A;  5AQF A;  1ZFU A;  1JZB A;  1NE5 A;  3ATV A;  1SN1 A;  2KPY A;  1ATR A;  4UJ0 A;  3L4I A;  1VNB A;  3FZF A;  1KV0 A;  5AQU A;  5AQZ A;  3QFU A;  3KP1 A;  1ZVG A;  2LT8 A;  2V7Z A;  5BN9 A;  2QWP A;  3LDQ A;  1NGG A;  2E3F A;  4H5R A;  1NPI A;  1UGL A;  1ATS A;  1P0A A;  2E3G A;  2KSK A;  3D2E B;  3D2F B;  3GL1 A;  2KGQ A;  2LJ7 A;  5BN8 A;  1NGJ A;  1BA0 A;  5F0X A;  5AQW A;  5AQR A;  3LDP A;  3IUC A;  5AQV A;  1LQH A;  1NGH A;  5FPE A;  4KYP A;  2KBK A;  5AQK A;  3KVG A;  2QWL A;  2LY6 A;  1BMR A;  4GNI A;  5AQG A;  5FPD A;  1NGD A;  3KOZ A;  1BK8 A;  2E8A A;  2ASC A;  2QWR A;  3E7R L;  3QFP A;  1L4V A;  1NGI A;  2JDQ D;  3D2F A;  2QXL A;  1ZUT A;  1CN2 A;  1JXC A;  3I33 A;  2QWM A;  4H5V A;  1KAZ A;  1TI5 A;  1ZU3 A;  2VY6 A;  3R2V A;  4IO8 A;  5BPN A;  1GPS A;  1ZYW A;  1HX1 A;  4HWI A;  1VNA A;  3E7U X;  3A8Y A;  5AQH A;  2BRZ A;  4AB0 A;  2G2K A;  1ZYV A;  2KBJ A;  3CW4 A;  2GL1 A;  1XRS B;  2SN3 A;  3LDL A;  2E0H A;  2KYQ A;  5EX5 A;  3C7N B;  1AHO A;  2YIL A;  1NRB A;  3M3Z A;  4UAD E;  2E88 A;  5AQS A;  3FZK A;  1MR4 A;  1HJO A;  1KAX A;  2N69 A;  1JKZ A;  1T1T A;  5FPM A;  1LQQ A;  3KC6 A;  5AQT A;  4UAE F;  1C56 A;  1PX9 A;  3QML A;  2N2Q A;  4AEI A;  2LN8 A;  1WT7 A;  3JXU A;  3KOW A;  2YIP A;  5BPM A;  1I2V A;  2YBR C;  1DQ7 A;  1B7D A;  1N4N A;  2LI7 A;  3PSM A;  1S3X A;  1SN4 A;  3C7N A;  1NGA A;  2QW9 A;  1DKG D;  1T0Z A;  2KBH A;  2N66 A;  1JZA A;  2NY9 X;  1P00 A;  1OZZ A;  3FZL A;  5AQM A;  1QQM A;  3KOX A;  4UAF E;  1QQO A;  5EXW A;  1WWN A;  2KHO A;  3QI7 A;  3KP0 A;  4CQK A;  5BPL A;  1AYJ A;  1NGC A;  1I6F A;  3L6Q A;  2YEO A;  1WMT A;  2QWN A;  2K35 A;  2KJA A;  1FH3 A;  3AY9 A;  1T7A A;  1KAY A;  5AR0 A; 
#chains in the Genus database with same CATH homology
 2M8B B;  1I6G A;  1PE4 A;  4AAZ A;  1T7E A;  2ATB A;  1OMY A;  1CHZ A;  1B3C A;  2A7T A;  5KK4 A;  2LR3 A;  4V1D C;  4HE7 A;  1SEG A;  2NY8 X;  1LQI A;  1T7B A;  2LJM A;  1C55 A;  1SNB A;  2B68 A;  2YC1 C;  1GPT A;  1I2U A;  1PTX A;  2I61 A;  1ICA A;  2LKB A;  2MZ0 A;  1ZVE A;  4HHF A;  1NH5 A;  1NRA A;  2LY5 A;  5CY0 A;  1BCG A;  1MYN A;  2N2R A;  1DJT A;  2B3C A;  1BRZ A;  1ZFU A;  1JZB A;  1NE5 A;  1SN1 A;  2KPY A;  4UJ0 A;  1VNB A;  1KV0 A;  1ZVG A;  2LT8 A;  2E3F A;  1NPI A;  2KSK A;  1P0A A;  2E3G A;  2KGQ A;  2LJ7 A;  1LQH A;  4KYP A;  2KBK A;  2LY6 A;  1BMR A;  1BK8 A;  2ASC A;  3E7R L;  1L4V A;  1ZUT A;  1CN2 A;  1JXC A;  1TI5 A;  1ZU3 A;  1GPS A;  1ZYW A;  1VNA A;  3E7U X;  2BRZ A;  4AB0 A;  1ZYV A;  2KBJ A;  2GL1 A;  2SN3 A;  2E0H A;  2KYQ A;  1AHO A;  1NRB A;  1MR4 A;  2N69 A;  1JKZ A;  1T1T A;  1LQQ A;  1C56 A;  1PX9 A;  4AEI A;  2N2Q A;  1WT7 A;  1I2V A;  2YBR C;  1DQ7 A;  1B7D A;  1N4N A;  2LI7 A;  3PSM A;  1SN4 A;  1T0Z A;  2KBH A;  2N66 A;  1JZA A;  2NY9 X;  1P00 A;  1OZZ A;  1WWN A;  4CQK A;  1AYJ A;  1I6F A;  2YEO A;  1WMT A;  2KJA A;  1FH3 A;  1T7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...