3E7RL

X-ray crystal structure of racemic plectasin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
40
structure length
40
Chain Sequence
GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plectasin
publication title Racemic crystallography of synthetic protein enantiomers used to determine the X-ray structure of plectasin by direct methods
pubmed doi rcsb
molecule tags Antimicrobial protein
total genus 9
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2008-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF01097 Defensin_2 Arthropod defensin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 3e7rL01
1T1TA 1NE5A 2KBHA 1NH5A 2LY5A 1LQIA 2A7TA 5KK4A 1SEGA 2LT8A 1BMRA 2LJ7A 1OMYA 2LI7A 2ATBA 2KYQA 1I2UA 2YC1C 1ICAA 2NY8X 1N4NA 1ZUTA 2E3FA 2E3GA 1WMTA 2N2RA 1B3CA 2KBJA 1P00A 2B68A 4AAZA 1B7DA 2LKBA 2N2QA 1LQHA 1GPSA 1NPIA 2KJAA 2KGQA 1WWNA 1PE4A 1NRAA 2KPYA 1AHOA 1T7AA 1SNBA 1JXCA 1I6FA 1MR4A 4CQKA 2KBKA 1WT7A 2LR3A 1TI5A 2N66A 1VNBA 1ZU3A 1SN4A 2YBRC 1ZFUA 4AEIA 2E0HA 1ZVEA 1SN1A 1L4VA 1C55A 4KYPA 1BRZA 4HHFA 1OZZA 1C56A 1DQ7A 1T0ZA 1ZVGA 4UJ0A 1T7BA 1FH3A 2YEOA 2B3CA 1AYJA 1NRBA 1P0AA 1CN2A 2LJMA 4AB0A 2MZ0A 2SN3A 1CHZA 1ZYWA 2I61A 3PSMA 2BRZA 1JZAA 1LQQA 3E7RL 2M8BB 2ASCA 1I6GA 1DJTA 2LY6A 1I2VA 1BK8A 1KV0A 1MYNA 1GPTA 3E7UX 5CY0A 1JZBA 2N69A 1BCGA 1PTXA 1T7EA 1PX9A 1ZYVA 1JKZA 4HE7A 4V1DC 2KSKA 2GL1A 1VNAA 2NY9X
chains in the Genus database with same CATH superfamily
1T1TA 4H5NA 5F2RA 1HPMA 5AQHA 5EVZA 5AQFA 1NE5A 2KBHA 5AQZA 1NGFA 1NH5A 1UGLA 3L56A 4H5VA 2QXLA 5EX5A 5BPNA 3A8YA 1QQNA 3C7NA 2LY5A 5AQOA 1LQIA 3QFPA 2A7TA 5KK4A 1SEGA 5BN8A 2LT8A 4UADE 2LN8A 2QWNA 1BMRA 3C7NB 5FPNA 2LJ7A 5FPMA 1OMYA 5AQUA 1NGGA 3LDQA 1YUWA 2LI7A 2ATBA 2KYQA 5AQMA 2QW9A 5AQSA 2YIOA 1I2UA 5BPMA 2QWMA 5AR0A 2YC1C 3BK3C 2NY8X 1ICAA 1N4NA 1ZUTA 2E3FA 2E3GA 1WMTA 2YIPA 2N2RA 3AY9A 2VY6A 2E8AA 5EY4A 2QWQA 1B3CA 2KBJA 1P00A 2B68A 4AAZA 3D2EA 1B7DA 1NGCA 2LKBA 2N2QA 3KOXA 4KBOA 4UAFE 1HJOA 1KAZA 1LQHA 5AQIA 1NPIA 2KJAA 1GPSA 2KGQA 3D2EB 4IO8A 1WWNA 3QI7A 1ATSA 1PE4A 2E88A 5AQRA 1NGAA 2K35A 5AQLA 3LDLA 3KP0A 1NRAA 1K8BA 2KPYA 5AQPA 1AHOA 3ATVA 3KC6A 3SF4D 1T7AA 3CW4A 1SNBA 1JXCA 1POIA 1I6FA 1MR4A 2QWOA 3FZKA 5AQWA 4CQKA 1BA0A 2KBKA 3L6QA 1WT7A 5EXWA 2LR3A 5AQTA 3LDOA 2QWRA 1TI5A 1QQOA 2N66A 2MN5A 1VNBA 1BUPA 1SN4A 1ZU3A 2YBRC 3JXUA 1ZFUA 1BA1A 3FZMA 4AEIA 1XRSB 2E0HA 3KOWA 2YILA 3L4IA 1DKGD 1ZVEA 1SN1A 1ATRA 2QWLA 1L4VA 3R2VA 1NGHA 5AQKA 1C55A 3KVGA 4KYPA 5AQQA 3D2FA 3GDQA 1QQMA 2E2FA 1KAYA 3IUCA 1BRZA 4HHFA 1OZZA 1C56A 3I33A 5AQGA 3KOYA 5F0XA 1DQ7A 1T0ZA 1S3XA 1ZVGA 2GMOA 3D2FB 4FSVA 1T7BA 4UJ0A 5AQNA 1FH3A 2YEOA 2B3CA 1AYJA 3ATUA 1NGDA 2BUPA 1NRBA 3FZHA 1P0AA 3FZLA 2KHOA 5AQVA 1CN2A 2LJMA 4AB0A 3FZFA 2JDQD 2MZ0A 1CHZA 1NGEA 1ZYWA 2SN3A 3KP1A 5F1XA 5FPEA 1NGBA 2I61A 3PSMA 3QFUA 2BRZA 1JZAA 1LQQA 5AQXA 4H5WA 3E7RL 3QMLA 5AQYA 2QWPA 2V7ZA 3CQXA 2M8BB 1NGIA 4UAEF 2ASCA 3FE1A 3KHWA 3KOZA 4GNIA 1I6GA 1DJTA 3LDPA 4H5RA 2LY6A 1I2VA 1NGJA 3HSCA 2G2KA 2MBKA 1BK8A 1KV0A 1MYNA 3M3ZA 3GKUA 1GPTA 5BN9A 1KAXA 3E7UX 4HWIA 5CY0A 1JZBA 2N69A 1BCGA 4FL9A 1PTXA 5FPDA 1T7EA 1HX1A 1PX9A 4H5TA 1ZYVA 5BPLA 1JKZA 3GL1A 4HE7A 3LDNA 4V1DC 5AQJA 2KSKA 2GL1A 1VNAA 2D56A 2NY9X
chains in the Genus database with same CATH topology
1T1TA 1NE5A 2KBHA 1NH5A 2LY5A 1LQIA 2A7TA 5KK4A 1SEGA 2LT8A 1BMRA 2LJ7A 1OMYA 2LI7A 2ATBA 2KYQA 1I2UA 2YC1C 1ICAA 2NY8X 1N4NA 1ZUTA 2E3FA 2E3GA 1WMTA 2N2RA 1B3CA 2KBJA 1P00A 2B68A 4AAZA 1B7DA 2LKBA 2N2QA 1LQHA 1GPSA 1NPIA 2KJAA 2KGQA 1WWNA 1PE4A 1NRAA 2KPYA 1AHOA 1T7AA 1SNBA 1JXCA 1I6FA 1MR4A 4CQKA 2KBKA 1WT7A 2LR3A 1TI5A 2N66A 1VNBA 1ZU3A 1SN4A 2YBRC 1ZFUA 4AEIA 2E0HA 1ZVEA 1SN1A 1L4VA 1C55A 4KYPA 1BRZA 4HHFA 1OZZA 1C56A 1DQ7A 1T0ZA 1ZVGA 4UJ0A 1T7BA 1FH3A 2YEOA 2B3CA 1AYJA 1NRBA 1P0AA 1CN2A 2LJMA 4AB0A 2MZ0A 2SN3A 1CHZA 1ZYWA 2I61A 3PSMA 2BRZA 1JZAA 1LQQA 3E7RL 2M8BB 2ASCA 1I6GA 1DJTA 2LY6A 1I2VA 1BK8A 1KV0A 1MYNA 1GPTA 3E7UX 5CY0A 1JZBA 2N69A 1BCGA 1PTXA 1T7EA 1PX9A 1ZYVA 1JKZA 4HE7A 4V1DC 2KSKA 2GL1A 1VNAA 2NY9X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1T A;  1NE5 A;  2KBH A;  1NH5 A;  2LY5 A;  1LQI A;  2A7T A;  5KK4 A;  1SEG A;  2LT8 A;  1BMR A;  2LJ7 A;  1OMY A;  2LI7 A;  2ATB A;  2KYQ A;  1I2U A;  2YC1 C;  1ICA A;  2NY8 X;  1N4N A;  1ZUT A;  2E3F A;  2E3G A;  1WMT A;  2N2R A;  1B3C A;  2KBJ A;  1P00 A;  2B68 A;  4AAZ A;  1B7D A;  2LKB A;  2N2Q A;  1LQH A;  1GPS A;  1NPI A;  2KJA A;  2KGQ A;  1WWN A;  1PE4 A;  1NRA A;  2KPY A;  1AHO A;  1T7A A;  1SNB A;  1JXC A;  1I6F A;  1MR4 A;  4CQK A;  2KBK A;  1WT7 A;  2LR3 A;  1TI5 A;  2N66 A;  1VNB A;  1ZU3 A;  1SN4 A;  2YBR C;  1ZFU A;  4AEI A;  2E0H A;  1ZVE A;  1SN1 A;  1L4V A;  1C55 A;  4KYP A;  1BRZ A;  4HHF A;  1OZZ A;  1C56 A;  1DQ7 A;  1T0Z A;  1ZVG A;  4UJ0 A;  1T7B A;  1FH3 A;  2YEO A;  2B3C A;  1AYJ A;  1NRB A;  1P0A A;  1CN2 A;  2LJM A;  4AB0 A;  2MZ0 A;  2SN3 A;  1CHZ A;  1ZYW A;  2I61 A;  3PSM A;  2BRZ A;  1JZA A;  1LQQ A;  3E7R L;  2M8B B;  2ASC A;  1I6G A;  1DJT A;  2LY6 A;  1I2V A;  1BK8 A;  1KV0 A;  1MYN A;  1GPT A;  3E7U X;  5CY0 A;  1JZB A;  2N69 A;  1BCG A;  1PTX A;  1T7E A;  1PX9 A;  1ZYV A;  1JKZ A;  4HE7 A;  4V1D C;  2KSK A;  2GL1 A;  1VNA A;  2NY9 X; 
#chains in the Genus database with same CATH topology
 1T1T A;  4H5N A;  5F2R A;  1HPM A;  5AQH A;  5EVZ A;  5AQF A;  1NE5 A;  2KBH A;  5AQZ A;  1NGF A;  1NH5 A;  1UGL A;  3L56 A;  4H5V A;  2QXL A;  5EX5 A;  5BPN A;  3A8Y A;  1QQN A;  3C7N A;  2LY5 A;  5AQO A;  1LQI A;  3QFP A;  2A7T A;  5KK4 A;  1SEG A;  5BN8 A;  2LT8 A;  4UAD E;  2LN8 A;  2QWN A;  1BMR A;  3C7N B;  5FPN A;  2LJ7 A;  5FPM A;  1OMY A;  5AQU A;  1NGG A;  3LDQ A;  1YUW A;  2LI7 A;  2ATB A;  2KYQ A;  5AQM A;  2QW9 A;  5AQS A;  2YIO A;  1I2U A;  5BPM A;  2QWM A;  5AR0 A;  2YC1 C;  3BK3 C;  2NY8 X;  1ICA A;  1N4N A;  1ZUT A;  2E3F A;  2E3G A;  1WMT A;  2YIP A;  2N2R A;  3AY9 A;  2VY6 A;  2E8A A;  5EY4 A;  2QWQ A;  1B3C A;  2KBJ A;  1P00 A;  2B68 A;  4AAZ A;  3D2E A;  1B7D A;  1NGC A;  2LKB A;  2N2Q A;  3KOX A;  4KBO A;  4UAF E;  1HJO A;  1KAZ A;  1LQH A;  5AQI A;  1NPI A;  2KJA A;  1GPS A;  2KGQ A;  3D2E B;  4IO8 A;  1WWN A;  3QI7 A;  1ATS A;  1PE4 A;  2E88 A;  5AQR A;  1NGA A;  2K35 A;  5AQL A;  3LDL A;  3KP0 A;  1NRA A;  1K8B A;  2KPY A;  5AQP A;  1AHO A;  3ATV A;  3KC6 A;  3SF4 D;  1T7A A;  3CW4 A;  1SNB A;  1JXC A;  1POI A;  1I6F A;  1MR4 A;  2QWO A;  3FZK A;  5AQW A;  4CQK A;  1BA0 A;  2KBK A;  3L6Q A;  1WT7 A;  5EXW A;  2LR3 A;  5AQT A;  3LDO A;  2QWR A;  1TI5 A;  1QQO A;  2N66 A;  2MN5 A;  1VNB A;  1BUP A;  1SN4 A;  1ZU3 A;  2YBR C;  3JXU A;  1ZFU A;  1BA1 A;  3FZM A;  4AEI A;  1XRS B;  2E0H A;  3KOW A;  2YIL A;  3L4I A;  1DKG D;  1ZVE A;  1SN1 A;  1ATR A;  2QWL A;  1L4V A;  3R2V A;  1NGH A;  5AQK A;  1C55 A;  3KVG A;  4KYP A;  5AQQ A;  3D2F A;  3GDQ A;  1QQM A;  2E2F A;  1KAY A;  3IUC A;  1BRZ A;  4HHF A;  1OZZ A;  1C56 A;  3I33 A;  5AQG A;  3KOY A;  5F0X A;  1DQ7 A;  1T0Z A;  1S3X A;  1ZVG A;  2GMO A;  3D2F B;  4FSV A;  1T7B A;  4UJ0 A;  5AQN A;  1FH3 A;  2YEO A;  2B3C A;  1AYJ A;  3ATU A;  1NGD A;  2BUP A;  1NRB A;  3FZH A;  1P0A A;  3FZL A;  2KHO A;  5AQV A;  1CN2 A;  2LJM A;  4AB0 A;  3FZF A;  2JDQ D;  2MZ0 A;  1CHZ A;  1NGE A;  1ZYW A;  2SN3 A;  3KP1 A;  5F1X A;  5FPE A;  1NGB A;  2I61 A;  3PSM A;  3QFU A;  2BRZ A;  1JZA A;  1LQQ A;  5AQX A;  4H5W A;  3E7R L;  3QML A;  5AQY A;  2QWP A;  2V7Z A;  3CQX A;  2M8B B;  1NGI A;  4UAE F;  2ASC A;  3FE1 A;  3KHW A;  3KOZ A;  4GNI A;  1I6G A;  1DJT A;  3LDP A;  4H5R A;  2LY6 A;  1I2V A;  1NGJ A;  3HSC A;  2G2K A;  2MBK A;  1BK8 A;  1KV0 A;  1MYN A;  3M3Z A;  3GKU A;  1GPT A;  5BN9 A;  1KAX A;  3E7U X;  4HWI A;  5CY0 A;  1JZB A;  2N69 A;  1BCG A;  4FL9 A;  1PTX A;  5FPD A;  1T7E A;  1HX1 A;  1PX9 A;  4H5T A;  1ZYV A;  5BPL A;  1JKZ A;  3GL1 A;  4HE7 A;  3LDN A;  4V1D C;  5AQJ A;  2KSK A;  2GL1 A;  1VNA A;  2D56 A;  2NY9 X; 
#chains in the Genus database with same CATH homology
 1T1T A;  1NE5 A;  2KBH A;  1NH5 A;  2LY5 A;  1LQI A;  2A7T A;  5KK4 A;  1SEG A;  2LT8 A;  1BMR A;  2LJ7 A;  1OMY A;  2LI7 A;  2ATB A;  2KYQ A;  1I2U A;  2YC1 C;  1ICA A;  2NY8 X;  1N4N A;  1ZUT A;  2E3F A;  2E3G A;  1WMT A;  2N2R A;  1B3C A;  2KBJ A;  1P00 A;  2B68 A;  4AAZ A;  1B7D A;  2LKB A;  2N2Q A;  1LQH A;  1GPS A;  1NPI A;  2KJA A;  2KGQ A;  1WWN A;  1PE4 A;  1NRA A;  2KPY A;  1AHO A;  1T7A A;  1SNB A;  1JXC A;  1I6F A;  1MR4 A;  4CQK A;  2KBK A;  1WT7 A;  2LR3 A;  1TI5 A;  2N66 A;  1VNB A;  1ZU3 A;  1SN4 A;  2YBR C;  1ZFU A;  4AEI A;  2E0H A;  1ZVE A;  1SN1 A;  1L4V A;  1C55 A;  4KYP A;  1BRZ A;  4HHF A;  1OZZ A;  1C56 A;  1DQ7 A;  1T0Z A;  1ZVG A;  4UJ0 A;  1T7B A;  1FH3 A;  2YEO A;  2B3C A;  1AYJ A;  1NRB A;  1P0A A;  1CN2 A;  2LJM A;  4AB0 A;  2MZ0 A;  2SN3 A;  1CHZ A;  1ZYW A;  2I61 A;  3PSM A;  2BRZ A;  1JZA A;  1LQQ A;  3E7R L;  2M8B B;  2ASC A;  1I6G A;  1DJT A;  2LY6 A;  1I2V A;  1BK8 A;  1KV0 A;  1MYN A;  1GPT A;  3E7U X;  5CY0 A;  1JZB A;  2N69 A;  1BCG A;  1PTX A;  1T7E A;  1PX9 A;  1ZYV A;  1JKZ A;  4HE7 A;  4V1D C;  2KSK A;  2GL1 A;  1VNA A;  2NY9 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...