2D56A

Solution structure of asabf, antibacterial peptide isolated from a nematode, ascaris suum
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
53
structure length
53
Chain Sequence
AVDFSSCARMDVPGLSKVAQGLCISSCKFQNCGTGHCEKRGGRPTCVCDRCGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and function of ASABFd18c, antibacterial peptide isolated from a nematode, asucaris suum
rcsb
molecule keywords ASABF
molecule tags Antibiotic
source organism Ascaris suum
total genus 10
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2005-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.110 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2d56A00
2D56A
chains in the Genus database with same CATH superfamily
4IO8A 3CQXA 1CN2A 2NY9X 1B3CA 3E7RL 5BN8A 3KVGA 1GPTA 2LN8A 5AQXA 1JZAA 2KBJA 4FL9A 1T7EA 4H5RA 1NRBA 2MBKA 5AQOA 1TI5A 4AB0A 3FZFA 5F1XA 1JXCA 5AQGA 3FZMA 2MN5A 2QWLA 5AQYA 1BA1A 1BCGA 3D2EB 1VNAA 1KAZA 1LQIA 3QMLA 3FZHA 5BPMA 1QQOA 2ATBA 1CHZA 2YEOA 2QW9A 1LQQA 1BUPA 2NY8X 3KOXA 1POIA 1P00A 4UJ0A 1I2UA 1OZZA 2I61A 2E3GA 1NGBA 1T7AA 2KJAA 1QQNA 2LJMA 1KAYA 1BA0A 2BRZA 2E0HA 5AQSA 4GNIA 1K8BA 4AEIA 3CW4A 3KOYA 3HSCA 1I6FA 3ATUA 3I33A 1ZVGA 2M8BB 4UAEF 1SNBA 2LJ7A 3FE1A 3PSMA 3KOWA 3L6QA 1ICAA 2LY5A 2KHOA 5EVZA 1NGFA 2N2QA 2E88A 5AQZA 5EX5A 2QWQA 5AQNA 1ZVEA 3M3ZA 2G2KA 2ASCA 1PTXA 3KP0A 1BRZA 3GL1A 2QWRA 4KYPA 1P0AA 1SN4A 1T0ZA 3IUCA 1MR4A 5F2RA 2QXLA 5BN9A 1S3XA 5BPNA 1MYNA 1DJTA 2N69A 2K35A 3L56A 1VNBA 5AQLA 1B7DA 1FH3A 1HX1A 2YIOA 2YC1C 1OMYA 1NGAA 1AYJA 5AQIA 5FPNA 2D56A 1BK8A 1ZUTA 2KPYA 1JKZA 2LR3A 2N66A 5AQMA 1C56A 1ZYVA 5AQQA 2BUPA 3L4IA 2JDQD 5EY4A 2QWNA 1NGJA 3A8YA 1SEGA 2B3CA 3ATVA 3LDQA 1BMRA 2GMOA 5AQUA 1XRSB 2E3FA 3FZKA 1NRAA 1T7BA 1NE5A 3C7NA 3QFUA 5AQFA 4HWIA 2GL1A 1LQHA 2V7ZA 3BK3C 4UAFE 3GDQA 4V1DC 3JXUA 3GKUA 5AQVA 3AY9A 1NGEA 5FPDA 5F0XA 2KYQA 1GPSA 1NGGA 5FPMA 1NH5A 3E7UX 2MZ0A 4H5NA 2KGQA 3QI7A 5BPLA 1NPIA 1I2VA 2B68A 3D2FA 2A7TA 2LY6A 4HHFA 5AQHA 5AQRA 1HJOA 5AQKA 5EXWA 3KP1A 3LDPA 1UGLA 2LI7A 1HPMA 2QWMA 2QWOA 2YILA 2VY6A 1NGHA 1PE4A 3FZLA 3LDLA 5AQTA 3LDOA 1I6GA 4HE7A 1WT7A 3QFPA 2LKBA 5FPEA 5AQWA 3C7NB 4AAZA 2E2FA 5AQJA 1L4VA 2E8AA 3SF4D 1DKGD 2QWPA 1JZBA 1T1TA 4CQKA 1QQMA 5AR0A 2KSKA 5AQPA 4FSVA 2KBHA 1ATRA 1KAXA 3R2VA 3LDNA 1NGDA 1ZYWA 4H5VA 2SN3A 2KBKA 3KOZA 3D2EA 4H5WA 1NGCA 4UADE 5KK4A 2N2RA 1C55A 2LT8A 1NGIA 1WWNA 1PX9A 1ATSA 1DQ7A 1KV0A 1WMTA 1N4NA 3D2FB 5CY0A 1SN1A 1YUWA 1ZU3A 2YIPA 4H5TA 4KBOA 2YBRC 1AHOA 3KC6A 3KHWA 1ZFUA
chains in the Genus database with same CATH topology
4IO8A 3CQXA 5BN8A 3KVGA 2LN8A 5AQXA 4FL9A 4H5RA 2MBKA 5AQOA 3FZFA 5F1XA 5AQGA 3FZMA 2MN5A 2QWLA 5AQYA 1BA1A 3D2EB 5BPMA 1KAZA 3QMLA 3FZHA 1QQOA 2QW9A 1BUPA 1POIA 1NGBA 1QQNA 1KAYA 1BA0A 5AQSA 4GNIA 3CW4A 3HSCA 3ATUA 3I33A 4UAEF 3FE1A 3L6QA 2KHOA 5EVZA 1NGFA 2E88A 5AQZA 5EX5A 2QWQA 5AQNA 3M3ZA 3GL1A 2QWRA 5BN9A 3IUCA 5F2RA 2QXLA 1S3XA 5BPNA 2K35A 3L56A 5AQLA 1HX1A 2YIOA 1NGAA 5AQIA 5FPNA 2D56A 5AQMA 5AQQA 2BUPA 3L4IA 2JDQD 5EY4A 2QWNA 1NGJA 3A8YA 3ATVA 3LDQA 2GMOA 5AQUA 3FZKA 3C7NA 3QFUA 5AQFA 4HWIA 3BK3C 4UAFE 2V7ZA 3GDQA 3JXUA 5AQVA 3AY9A 1NGEA 5FPDA 5F0XA 1NGGA 5FPMA 4H5NA 3QI7A 5BPLA 3D2FA 5AQHA 5AQRA 1HJOA 5AQKA 5EXWA 3LDPA 1HPMA 2QWMA 2QWOA 2YILA 2VY6A 1NGHA 3LDLA 3FZLA 5AQTA 3LDOA 3QFPA 5FPEA 5AQWA 3C7NB 2E2FA 5AQJA 2E8AA 3SF4D 1DKGD 2QWPA 1QQMA 5AR0A 5AQPA 4FSVA 1ATRA 1KAXA 3R2VA 3LDNA 1NGDA 4H5VA 4UADE 3D2EA 4H5WA 1NGIA 1ATSA 3D2FB 1YUWA 4H5TA 2YIPA 4KBOA 3KC6A 3KHWA 1NGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D56 A; 
#chains in the Genus database with same CATH topology
 4IO8 A;  3CQX A;  1CN2 A;  2NY9 X;  1B3C A;  3E7R L;  5BN8 A;  3KVG A;  1GPT A;  2LN8 A;  5AQX A;  1JZA A;  2KBJ A;  4FL9 A;  1T7E A;  4H5R A;  1NRB A;  2MBK A;  5AQO A;  1TI5 A;  4AB0 A;  3FZF A;  5F1X A;  1JXC A;  5AQG A;  3FZM A;  2MN5 A;  2QWL A;  5AQY A;  1BA1 A;  1BCG A;  3D2E B;  1VNA A;  1KAZ A;  1LQI A;  3QML A;  3FZH A;  5BPM A;  1QQO A;  2ATB A;  1CHZ A;  2YEO A;  2QW9 A;  1LQQ A;  1BUP A;  2NY8 X;  3KOX A;  1POI A;  1P00 A;  4UJ0 A;  1I2U A;  1OZZ A;  2I61 A;  2E3G A;  1NGB A;  1T7A A;  2KJA A;  1QQN A;  2LJM A;  1KAY A;  1BA0 A;  2BRZ A;  2E0H A;  5AQS A;  4GNI A;  1K8B A;  4AEI A;  3CW4 A;  3KOY A;  3HSC A;  1I6F A;  3ATU A;  3I33 A;  1ZVG A;  2M8B B;  4UAE F;  1SNB A;  2LJ7 A;  3FE1 A;  3PSM A;  3KOW A;  3L6Q A;  1ICA A;  2LY5 A;  2KHO A;  5EVZ A;  1NGF A;  2N2Q A;  2E88 A;  5AQZ A;  5EX5 A;  2QWQ A;  5AQN A;  1ZVE A;  3M3Z A;  2G2K A;  2ASC A;  1PTX A;  3KP0 A;  1BRZ A;  3GL1 A;  2QWR A;  4KYP A;  1P0A A;  1SN4 A;  1T0Z A;  3IUC A;  1MR4 A;  5F2R A;  2QXL A;  5BN9 A;  1S3X A;  5BPN A;  1MYN A;  1DJT A;  2N69 A;  2K35 A;  3L56 A;  1VNB A;  5AQL A;  1B7D A;  1FH3 A;  1HX1 A;  2YIO A;  2YC1 C;  1OMY A;  1NGA A;  1AYJ A;  5AQI A;  5FPN A;  2D56 A;  1BK8 A;  1ZUT A;  2KPY A;  1JKZ A;  2LR3 A;  2N66 A;  5AQM A;  1C56 A;  1ZYV A;  5AQQ A;  2BUP A;  3L4I A;  2JDQ D;  5EY4 A;  2QWN A;  1NGJ A;  3A8Y A;  1SEG A;  2B3C A;  3ATV A;  3LDQ A;  1BMR A;  2GMO A;  5AQU A;  1XRS B;  2E3F A;  3FZK A;  1NRA A;  1T7B A;  1NE5 A;  3C7N A;  3QFU A;  5AQF A;  4HWI A;  2GL1 A;  1LQH A;  2V7Z A;  3BK3 C;  4UAF E;  3GDQ A;  4V1D C;  3JXU A;  3GKU A;  5AQV A;  3AY9 A;  1NGE A;  5FPD A;  5F0X A;  2KYQ A;  1GPS A;  1NGG A;  5FPM A;  1NH5 A;  3E7U X;  2MZ0 A;  4H5N A;  2KGQ A;  3QI7 A;  5BPL A;  1NPI A;  1I2V A;  2B68 A;  3D2F A;  2A7T A;  2LY6 A;  4HHF A;  5AQH A;  5AQR A;  1HJO A;  5AQK A;  5EXW A;  3KP1 A;  3LDP A;  1UGL A;  2LI7 A;  1HPM A;  2QWM A;  2QWO A;  2YIL A;  2VY6 A;  1NGH A;  1PE4 A;  3FZL A;  3LDL A;  5AQT A;  3LDO A;  1I6G A;  4HE7 A;  1WT7 A;  3QFP A;  2LKB A;  5FPE A;  5AQW A;  3C7N B;  4AAZ A;  2E2F A;  5AQJ A;  1L4V A;  2E8A A;  3SF4 D;  1DKG D;  2QWP A;  1JZB A;  1T1T A;  4CQK A;  1QQM A;  5AR0 A;  2KSK A;  5AQP A;  4FSV A;  2KBH A;  1ATR A;  1KAX A;  3R2V A;  3LDN A;  1NGD A;  1ZYW A;  4H5V A;  2SN3 A;  2KBK A;  3KOZ A;  3D2E A;  4H5W A;  1NGC A;  4UAD E;  5KK4 A;  2N2R A;  1C55 A;  2LT8 A;  1NGI A;  1WWN A;  1PX9 A;  1ATS A;  1DQ7 A;  1KV0 A;  1WMT A;  1N4N A;  3D2F B;  5CY0 A;  1SN1 A;  1YUW A;  1ZU3 A;  2YIP A;  4H5T A;  4KBO A;  2YBR C;  1AHO A;  3KC6 A;  3KHW A;  1ZFU A; 
#chains in the Genus database with same CATH homology
 4IO8 A;  3CQX A;  5BN8 A;  3KVG A;  2LN8 A;  5AQX A;  4FL9 A;  4H5R A;  2MBK A;  5AQO A;  3FZF A;  5F1X A;  5AQG A;  3FZM A;  2MN5 A;  2QWL A;  5AQY A;  1BA1 A;  3D2E B;  5BPM A;  1KAZ A;  3QML A;  3FZH A;  1QQO A;  2QW9 A;  1BUP A;  1POI A;  1NGB A;  1QQN A;  1KAY A;  1BA0 A;  5AQS A;  4GNI A;  3CW4 A;  3HSC A;  3ATU A;  3I33 A;  4UAE F;  3FE1 A;  3L6Q A;  2KHO A;  5EVZ A;  1NGF A;  2E88 A;  5AQZ A;  5EX5 A;  2QWQ A;  5AQN A;  3M3Z A;  3GL1 A;  2QWR A;  5BN9 A;  3IUC A;  5F2R A;  2QXL A;  1S3X A;  5BPN A;  2K35 A;  3L56 A;  5AQL A;  1HX1 A;  2YIO A;  1NGA A;  5AQI A;  5FPN A;  2D56 A;  5AQM A;  5AQQ A;  2BUP A;  3L4I A;  2JDQ D;  5EY4 A;  2QWN A;  1NGJ A;  3A8Y A;  3ATV A;  3LDQ A;  2GMO A;  5AQU A;  3FZK A;  3C7N A;  3QFU A;  5AQF A;  4HWI A;  3BK3 C;  4UAF E;  2V7Z A;  3GDQ A;  3JXU A;  5AQV A;  3AY9 A;  1NGE A;  5FPD A;  5F0X A;  1NGG A;  5FPM A;  4H5N A;  3QI7 A;  5BPL A;  3D2F A;  5AQH A;  5AQR A;  1HJO A;  5AQK A;  5EXW A;  3LDP A;  1HPM A;  2QWM A;  2QWO A;  2YIL A;  2VY6 A;  1NGH A;  3LDL A;  3FZL A;  5AQT A;  3LDO A;  3QFP A;  5FPE A;  5AQW A;  3C7N B;  2E2F A;  5AQJ A;  2E8A A;  3SF4 D;  1DKG D;  2QWP A;  1QQM A;  5AR0 A;  5AQP A;  4FSV A;  1ATR A;  1KAX A;  3R2V A;  3LDN A;  1NGD A;  4H5V A;  4UAD E;  3D2E A;  4H5W A;  1NGI A;  1ATS A;  3D2F B;  1YUW A;  4H5T A;  2YIP A;  4KBO A;  3KC6 A;  3KHW A;  1NGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...