2D56A

Solution structure of asabf, antibacterial peptide isolated from a nematode, ascaris suum
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
53
structure length
53
Chain Sequence
AVDFSSCARMDVPGLSKVAQGLCISSCKFQNCGTGHCEKRGGRPTCVCDRCGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASABF
publication title Solution structure and function of ASABFd18c, antibacterial peptide isolated from a nematode, asucaris suum
rcsb
source organism Ascaris suum
molecule tags Antibiotic
total genus 10
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2005-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.110 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2d56A00
2D56A
chains in the Genus database with same CATH superfamily
4AEIA 1OMYA 3E7RL 1ZYWA 3C7NB 3QI7A 3HSCA 5AQKA 5AQMA 2YEOA 4GNIA 4CQKA 1NPIA 1SNBA 2E2FA 1VNBA 2LKBA 1DQ7A 2NY8X 4HE7A 5BPLA 3D2FA 2D56A 1LQQA 5AR0A 5EY4A 1T7AA 3M3ZA 1ATRA 3QFUA 3KOYA 2QWNA 2SN3A 2QWRA 2A7TA 2KYQA 2YILA 3LDOA 1BA0A 5FPMA 2YC1C 1T1TA 2KPYA 1NGBA 5AQQA 1BUPA 1DKGD 3D2EB 5AQUA 1BMRA 3C7NA 1NGHA 5BN8A 1HX1A 1MYNA 1NE5A 1NGEA 4AAZA 4UJ0A 5EX5A 3FZKA 5AQSA 5BN9A 1BCGA 1PX9A 1ATSA 2QWQA 1HPMA 1BA1A 1LQIA 1ZFUA 2B68A 2KJAA 3LDNA 1PE4A 3FZFA 1T7EA 4V1DC 2BUPA 2YIOA 5BPMA 3E7UX 2QWMA 4H5VA 5F1XA 1I6GA 5AQZA 1I2VA 1L4VA 2KBHA 4FL9A 2GMOA 2K35A 2N69A 2MZ0A 2LJ7A 1S3XA 3CQXA 1ZU3A 2ATBA 4HWIA 1WMTA 4AB0A 4H5NA 1NGDA 3D2EA 5AQHA 1JXCA 5AQGA 1QQOA 3R2VA 5FPNA 5AQXA 1I2UA 1ZUTA 4H5RA 5AQOA 5AQPA 3ATVA 5AQYA 4UADE 5AQNA 3KOXA 1JKZA 2G2KA 3KHWA 5AQIA 2KBJA 3KP1A 5AQVA 1QQMA 1GPTA 1T0ZA 3L6QA 2NY9X 2KBKA 1P0AA 3JXUA 1KAYA 1XRSB 2N2QA 1ZYVA 3FE1A 2V7ZA 5AQRA 5AQLA 5FPDA 1JZAA 1AHOA 2QWOA 3L4IA 5BPNA 1K8BA 3KOZA 4H5WA 4UAEF 2BRZA 2QXLA 1DJTA 1PTXA 4HHFA 3IUCA 1POIA 2KSKA 3FZHA 1ZVGA 1T7BA 5AQFA 2LN8A 1OZZA 2E88A 2ASCA 2E3FA 2LI7A 3GL1A 5EXWA 1C56A 1UGLA 3GDQA 2LY6A 3LDPA 1NGIA 1I6FA 2LR3A 3D2FB 2VY6A 5KK4A 1ICAA 1QQNA 1NRAA 2KGQA 2KHOA 3LDQA 1AYJA 4FSVA 1B7DA 3KVGA 5AQWA 2E0HA 5AQJA 5AQTA 5F2RA 3I33A 3FZMA 3PSMA 1B3CA 3BK3C 3KP0A 2LY5A 3ATUA 2E8AA 3FZLA 2E3GA 2YBRC 3LDLA 2QW9A 1NGJA 1NGFA 1NH5A 2GL1A 2N2RA 2YIPA 4UAFE 1BK8A 1BRZA 2N66A 1ZVEA 3A8YA 2MN5A 1JZBA 2M8BB 3KC6A 3AY9A 5F0XA 2QWPA 4KYPA 3SF4D 1VNAA 3KOWA 1NGCA 1SN1A 3CW4A 3GKUA 1HJOA 2MBKA 1C55A 1MR4A 1WT7A 3QFPA 4H5TA 2JDQD 1GPSA 3L56A 1KAZA 5CY0A 1N4NA 2LT8A 4KBOA 5EVZA 2I61A 1FH3A 4IO8A 1P00A 1SEGA 1NGAA 1SN4A 2QWLA 1CHZA 1CN2A 1YUWA 1KAXA 1NRBA 1NGGA 2LJMA 5FPEA 1TI5A 3QMLA 1WWNA 1KV0A 1LQHA 2B3CA
chains in the Genus database with same CATH topology
3C7NB 3QI7A 3HSCA 5AQKA 5AQMA 4GNIA 2E2FA 5BPLA 3D2FA 2D56A 5AR0A 5EY4A 3M3ZA 1ATRA 3QFUA 2QWNA 2QWRA 2YILA 3LDOA 1BA0A 5FPMA 5AQQA 1NGBA 1BUPA 1DKGD 3D2EB 5AQUA 3C7NA 1NGHA 5BN8A 1HX1A 1NGEA 5EX5A 3FZKA 5AQSA 5BN9A 2QWQA 1HPMA 1BA1A 3LDQA 3LDNA 3FZFA 2BUPA 2YIOA 5BPMA 4H5VA 2QWMA 5F1XA 5AQZA 4FL9A 2GMOA 2K35A 1S3XA 3CQXA 4HWIA 4H5NA 1NGDA 3D2EA 5AQHA 5AQGA 1QQOA 3R2VA 5FPNA 5AQXA 4H5RA 5AQOA 5AQPA 3ATVA 5AQYA 4UADE 5AQNA 3KHWA 5AQIA 5AQVA 1QQMA 3L6QA 3JXUA 1KAYA 3FE1A 2V7ZA 5AQRA 5AQLA 5FPDA 3L4IA 2QWOA 5BPNA 4UAEF 4H5WA 2QXLA 3IUCA 1POIA 3FZHA 5AQFA 2LN8A 2E88A 3GL1A 5EXWA 3GDQA 3LDPA 1NGIA 3D2FB 2VY6A 1QQNA 2KHOA 4FSVA 3KVGA 5AQWA 5AQTA 5AQJA 3I33A 3FZMA 3BK3C 3ATUA 2E8AA 3FZLA 3LDLA 2QW9A 1NGJA 1NGFA 4UAFE 2YIPA 3A8YA 2MN5A 3KC6A 3AY9A 5F0XA 2QWPA 3SF4D 1NGCA 3CW4A 1HJOA 2MBKA 3QFPA 4H5TA 2JDQD 3L56A 1KAZA 4KBOA 5EVZA 4IO8A 1NGAA 2QWLA 1YUWA 1KAXA 1NGGA 5FPEA 3QMLA 1ATSA 5F2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D56 A; 
#chains in the Genus database with same CATH topology
 4AEI A;  1OMY A;  3E7R L;  1ZYW A;  3C7N B;  3QI7 A;  3HSC A;  5AQK A;  5AQM A;  2YEO A;  4GNI A;  4CQK A;  1NPI A;  1SNB A;  2E2F A;  1VNB A;  2LKB A;  1DQ7 A;  2NY8 X;  4HE7 A;  5BPL A;  3D2F A;  2D56 A;  1LQQ A;  5AR0 A;  5EY4 A;  1T7A A;  3M3Z A;  1ATR A;  3QFU A;  3KOY A;  2QWN A;  2SN3 A;  2QWR A;  2A7T A;  2KYQ A;  2YIL A;  3LDO A;  1BA0 A;  5FPM A;  2YC1 C;  1T1T A;  2KPY A;  1NGB A;  5AQQ A;  1BUP A;  1DKG D;  3D2E B;  5AQU A;  1BMR A;  3C7N A;  1NGH A;  5BN8 A;  1HX1 A;  1MYN A;  1NE5 A;  1NGE A;  4AAZ A;  4UJ0 A;  5EX5 A;  3FZK A;  5AQS A;  5BN9 A;  1BCG A;  1PX9 A;  1ATS A;  2QWQ A;  1HPM A;  1BA1 A;  1LQI A;  1ZFU A;  2B68 A;  2KJA A;  3LDN A;  1PE4 A;  3FZF A;  1T7E A;  4V1D C;  2BUP A;  2YIO A;  5BPM A;  3E7U X;  2QWM A;  4H5V A;  5F1X A;  1I6G A;  5AQZ A;  1I2V A;  1L4V A;  2KBH A;  4FL9 A;  2GMO A;  2K35 A;  2N69 A;  2MZ0 A;  2LJ7 A;  1S3X A;  3CQX A;  1ZU3 A;  2ATB A;  4HWI A;  1WMT A;  4AB0 A;  4H5N A;  1NGD A;  3D2E A;  5AQH A;  1JXC A;  5AQG A;  1QQO A;  3R2V A;  5FPN A;  5AQX A;  1I2U A;  1ZUT A;  4H5R A;  5AQO A;  5AQP A;  3ATV A;  5AQY A;  4UAD E;  5AQN A;  3KOX A;  1JKZ A;  2G2K A;  3KHW A;  5AQI A;  2KBJ A;  3KP1 A;  5AQV A;  1QQM A;  1GPT A;  1T0Z A;  3L6Q A;  2NY9 X;  2KBK A;  1P0A A;  3JXU A;  1KAY A;  1XRS B;  2N2Q A;  1ZYV A;  3FE1 A;  2V7Z A;  5AQR A;  5AQL A;  5FPD A;  1JZA A;  1AHO A;  2QWO A;  3L4I A;  5BPN A;  1K8B A;  3KOZ A;  4H5W A;  4UAE F;  2BRZ A;  2QXL A;  1DJT A;  1PTX A;  4HHF A;  3IUC A;  1POI A;  2KSK A;  3FZH A;  1ZVG A;  1T7B A;  5AQF A;  2LN8 A;  1OZZ A;  2E88 A;  2ASC A;  2E3F A;  2LI7 A;  3GL1 A;  5EXW A;  1C56 A;  1UGL A;  3GDQ A;  2LY6 A;  3LDP A;  1NGI A;  1I6F A;  2LR3 A;  3D2F B;  2VY6 A;  5KK4 A;  1ICA A;  1QQN A;  1NRA A;  2KGQ A;  2KHO A;  3LDQ A;  1AYJ A;  4FSV A;  1B7D A;  3KVG A;  5AQW A;  2E0H A;  5AQJ A;  5AQT A;  5F2R A;  3I33 A;  3FZM A;  3PSM A;  1B3C A;  3BK3 C;  3KP0 A;  2LY5 A;  3ATU A;  2E8A A;  3FZL A;  2E3G A;  2YBR C;  3LDL A;  2QW9 A;  1NGJ A;  1NGF A;  1NH5 A;  2GL1 A;  2N2R A;  2YIP A;  4UAF E;  1BK8 A;  1BRZ A;  2N66 A;  1ZVE A;  3A8Y A;  2MN5 A;  1JZB A;  2M8B B;  3KC6 A;  3AY9 A;  5F0X A;  2QWP A;  4KYP A;  3SF4 D;  1VNA A;  3KOW A;  1NGC A;  1SN1 A;  3CW4 A;  3GKU A;  1HJO A;  2MBK A;  1C55 A;  1MR4 A;  1WT7 A;  3QFP A;  4H5T A;  2JDQ D;  1GPS A;  3L56 A;  1KAZ A;  5CY0 A;  1N4N A;  2LT8 A;  4KBO A;  5EVZ A;  2I61 A;  1FH3 A;  4IO8 A;  1P00 A;  1SEG A;  1NGA A;  1SN4 A;  2QWL A;  1CHZ A;  1CN2 A;  1YUW A;  1KAX A;  1NRB A;  1NGG A;  2LJM A;  5FPE A;  1TI5 A;  3QML A;  1WWN A;  1KV0 A;  1LQH A;  2B3C A; 
#chains in the Genus database with same CATH homology
 3C7N B;  3QI7 A;  3HSC A;  5AQK A;  5AQM A;  4GNI A;  2E2F A;  5BPL A;  3D2F A;  2D56 A;  5AR0 A;  5EY4 A;  3M3Z A;  1ATR A;  3QFU A;  2QWN A;  2QWR A;  2YIL A;  3LDO A;  1BA0 A;  5FPM A;  5AQQ A;  1NGB A;  1BUP A;  1DKG D;  3D2E B;  5AQU A;  3C7N A;  1NGH A;  5BN8 A;  1HX1 A;  1NGE A;  5EX5 A;  3FZK A;  5AQS A;  5BN9 A;  2QWQ A;  1HPM A;  1BA1 A;  3LDQ A;  3LDN A;  3FZF A;  2BUP A;  2YIO A;  5BPM A;  4H5V A;  2QWM A;  5F1X A;  5AQZ A;  4FL9 A;  2GMO A;  2K35 A;  1S3X A;  3CQX A;  4HWI A;  4H5N A;  1NGD A;  3D2E A;  5AQH A;  5AQG A;  1QQO A;  3R2V A;  5FPN A;  5AQX A;  4H5R A;  5AQO A;  5AQP A;  3ATV A;  5AQY A;  4UAD E;  5AQN A;  3KHW A;  5AQI A;  5AQV A;  1QQM A;  3L6Q A;  3JXU A;  1KAY A;  3FE1 A;  2V7Z A;  5AQR A;  5AQL A;  5FPD A;  3L4I A;  2QWO A;  5BPN A;  4UAE F;  4H5W A;  2QXL A;  3IUC A;  1POI A;  3FZH A;  5AQF A;  2LN8 A;  2E88 A;  3GL1 A;  5EXW A;  3GDQ A;  3LDP A;  1NGI A;  3D2F B;  2VY6 A;  1QQN A;  2KHO A;  4FSV A;  3KVG A;  5AQW A;  5AQT A;  5AQJ A;  3I33 A;  3FZM A;  3BK3 C;  3ATU A;  2E8A A;  3FZL A;  3LDL A;  2QW9 A;  1NGJ A;  1NGF A;  4UAF E;  2YIP A;  3A8Y A;  2MN5 A;  3KC6 A;  3AY9 A;  5F0X A;  2QWP A;  3SF4 D;  1NGC A;  3CW4 A;  1HJO A;  2MBK A;  3QFP A;  4H5T A;  2JDQ D;  3L56 A;  1KAZ A;  4KBO A;  5EVZ A;  4IO8 A;  1NGA A;  2QWL A;  1YUW A;  1KAX A;  1NGG A;  5FPE A;  3QML A;  1ATS A;  5F2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...