3BK3C

Crystal structure of the complex of bmp-2 and the first von willebrand domain type c of crossveinless-2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
67
structure length
67
Chain Sequence
WLITGTEASCENEGEVLHIPNITDNPCISCVCLNQKAECKQEKCAPLAEDCALVVKQTGACCEKCKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords Bone morphogenetic protein 2
publication title Crystal structure analysis reveals how the Chordin family member crossveinless 2 blocks BMP-2 receptor binding
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.190 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 3bk3C00
2MBKA 3BK3C
chains in the Genus database with same CATH superfamily
1JZAA 1C56A 1OMYA 1ZFUA 1QQNA 1HJOA 1VNAA 4H5RA 3KOYA 3LDQA 1SN1A 2LT8A 5FPMA 1ZVGA 1NGCA 2I61A 1BA1A 2A7TA 3QMLA 5AQQA 1SN4A 5AQWA 1DKGD 4H5NA 1NGIA 1ATRA 2KBHA 2LI7A 1BMRA 5AR0A 1PTXA 4H5TA 5AQMA 2MZ0A 1T7AA 5BPLA 2LKBA 2YIOA 4AB0A 1NRBA 5F1XA 2KSKA 5FPDA 5AQRA 1K8BA 4CQKA 3PSMA 3E7RL 1AYJA 5AQVA 2LR3A 1JZBA 2K35A 3KHWA 2NY8X 1WWNA 3GKUA 1BUPA 1NE5A 1TI5A 1WMTA 1B7DA 1WT7A 3GL1A 2N66A 1S3XA 1I2VA 5AQNA 4IO8A 2E3GA 1BRZA 5FPEA 1C55A 1N4NA 2QWMA 1BCGA 3ATVA 3CQXA 3FZFA 3HSCA 3LDLA 2YEOA 3D2EB 4UAFE 3FZMA 3L4IA 2M8BB 5BPMA 1SEGA 2N2RA 2B3CA 5AQOA 5AQXA 1NGJA 2KYQA 5AQYA 5BN9A 5AQTA 2QWRA 5AQJA 3QFPA 5BPNA 1T1TA 2YILA 1ICAA 3LDPA 1NGGA 1NH5A 2JDQD 1KV0A 4UAEF 3M3ZA 3KOZA 1MYNA 2QXLA 3AY9A 5FPNA 3D2EA 4KYPA 1QQOA 1OZZA 1NGDA 4HWIA 3L56A 2V7ZA 2E8AA 3FZHA 1JKZA 1I6FA 3FE1A 4H5VA 3LDOA 2LJ7A 3ATUA 1HX1A 2N69A 2QW9A 3A8YA 4FSVA 4KBOA 5AQUA 3BK3C 3C7NB 1HPMA 3D2FB 3FZKA 2QWPA 5AQKA 2KGQA 2VY6A 4AEIA 1KAXA 5AQZA 2ASCA 1GPTA 2QWNA 5AQSA 4AAZA 5BN8A 1XRSB 4HHFA 2KJAA 3IUCA 1MR4A 2E0HA 3KVGA 3QI7A 3I33A 5F2RA 3KOXA 5EXWA 2LY5A 3E7UX 3FZLA 4UJ0A 2MN5A 1L4VA 2B68A 5EY4A 3C7NA 1JXCA 1SNBA 2QWOA 2YC1C 4H5WA 1VNBA 5AQPA 2LJMA 3KC6A 1NGHA 2N2QA 1POIA 1NGBA 1T7BA 1ZU3A 5F0XA 2KHOA 2QWLA 1LQIA 3QFUA 1UGLA 2BUPA 1YUWA 3KP0A 1GPSA 5AQIA 2LY6A 4HE7A 5KK4A 1I2UA 2KBKA 1AHOA 3L6QA 5CY0A 1KAZA 1NGFA 1NGEA 2BRZA 3R2VA 3KOWA 2KPYA 5EX5A 2LN8A 2GL1A 1BA0A 3JXUA 1QQMA 4GNIA 3CW4A 4V1DC 1NGAA 5AQHA 5AQFA 1ZYVA 2E2FA 2YIPA 2GMOA 1CHZA 2D56A 1NPIA 2NY9X 3GDQA 3KP1A 3LDNA 2QWQA 5AQLA 1DJTA 1CN2A 2MBKA 5AQGA 1T7EA 1BK8A 1DQ7A 5EVZA 1I6GA 1KAYA 2E3FA 1NRAA 2YBRC 2G2KA 3D2FA 3SF4D 1ATSA 1LQHA 1ZYWA 2KBJA 4FL9A 1ZUTA 1PX9A 2SN3A 1T0ZA 1PE4A 2ATBA 1ZVEA 1FH3A 2E88A 4UADE 1B3CA 1P0AA 1P00A 1LQQA
chains in the Genus database with same CATH topology
1QQNA 1HJOA 4H5RA 5FPMA 3LDQA 1NGCA 1BA1A 5AQQA 3QMLA 5AQWA 1DKGD 4H5NA 1NGIA 1ATRA 5AR0A 4H5TA 5AQMA 5BPLA 2YIOA 5F1XA 5FPDA 5AQRA 5AQVA 2K35A 3KHWA 1BUPA 3GL1A 1S3XA 5AQNA 4IO8A 5FPEA 2QWMA 3ATVA 3CQXA 3FZFA 3HSCA 3LDLA 3D2EB 4UAFE 3FZMA 3L4IA 5BPMA 5AQXA 5AQOA 1NGJA 5AQYA 5BN9A 5AQTA 2QWRA 5AQJA 3QFPA 5BPNA 2YILA 3LDPA 1NGGA 2JDQD 4UAEF 3M3ZA 2QXLA 3AY9A 5FPNA 3D2EA 1QQOA 1NGDA 4HWIA 3L56A 3FZHA 2E8AA 2V7ZA 3FE1A 4H5VA 3LDOA 3ATUA 1HX1A 2QW9A 3A8YA 4FSVA 4KBOA 5AQUA 3BK3C 3C7NB 1HPMA 3D2FB 3FZKA 2QWPA 5AQKA 2VY6A 1KAXA 5AQZA 2QWNA 5AQSA 5BN8A 3IUCA 3KVGA 3QI7A 5F2RA 3I33A 5EXWA 3FZLA 2MN5A 5EY4A 3C7NA 4H5WA 2QWOA 5AQPA 3KC6A 1NGHA 1POIA 1NGBA 5F0XA 2KHOA 2QWLA 3QFUA 2BUPA 1YUWA 5AQIA 3L6QA 1KAZA 1NGFA 1NGEA 3R2VA 5EX5A 2LN8A 1BA0A 3JXUA 1QQMA 4GNIA 3CW4A 5AQHA 1NGAA 5AQFA 2E2FA 2YIPA 2GMOA 2D56A 3GDQA 3LDNA 2QWQA 5AQLA 2MBKA 5AQGA 5EVZA 1KAYA 3D2FA 3SF4D 1ATSA 4FL9A 2E88A 4UADE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBK A;  3BK3 C; 
#chains in the Genus database with same CATH topology
 1JZA A;  1C56 A;  1OMY A;  1ZFU A;  1QQN A;  1HJO A;  1VNA A;  4H5R A;  3KOY A;  3LDQ A;  1SN1 A;  2LT8 A;  5FPM A;  1ZVG A;  1NGC A;  2I61 A;  1BA1 A;  2A7T A;  3QML A;  5AQQ A;  1SN4 A;  5AQW A;  1DKG D;  4H5N A;  1NGI A;  1ATR A;  2KBH A;  2LI7 A;  1BMR A;  5AR0 A;  1PTX A;  4H5T A;  5AQM A;  2MZ0 A;  1T7A A;  5BPL A;  2LKB A;  2YIO A;  4AB0 A;  1NRB A;  5F1X A;  2KSK A;  5FPD A;  5AQR A;  1K8B A;  4CQK A;  3PSM A;  3E7R L;  1AYJ A;  5AQV A;  2LR3 A;  1JZB A;  2K35 A;  3KHW A;  2NY8 X;  1WWN A;  3GKU A;  1BUP A;  1NE5 A;  1TI5 A;  1WMT A;  1B7D A;  1WT7 A;  3GL1 A;  2N66 A;  1S3X A;  1I2V A;  5AQN A;  4IO8 A;  2E3G A;  1BRZ A;  5FPE A;  1C55 A;  1N4N A;  2QWM A;  1BCG A;  3ATV A;  3CQX A;  3FZF A;  3HSC A;  3LDL A;  2YEO A;  3D2E B;  4UAF E;  3FZM A;  3L4I A;  2M8B B;  5BPM A;  1SEG A;  2N2R A;  2B3C A;  5AQO A;  5AQX A;  1NGJ A;  2KYQ A;  5AQY A;  5BN9 A;  5AQT A;  2QWR A;  5AQJ A;  3QFP A;  5BPN A;  1T1T A;  2YIL A;  1ICA A;  3LDP A;  1NGG A;  1NH5 A;  2JDQ D;  1KV0 A;  4UAE F;  3M3Z A;  3KOZ A;  1MYN A;  2QXL A;  3AY9 A;  5FPN A;  3D2E A;  4KYP A;  1QQO A;  1OZZ A;  1NGD A;  4HWI A;  3L56 A;  2V7Z A;  2E8A A;  3FZH A;  1JKZ A;  1I6F A;  3FE1 A;  4H5V A;  3LDO A;  2LJ7 A;  3ATU A;  1HX1 A;  2N69 A;  2QW9 A;  3A8Y A;  4FSV A;  4KBO A;  5AQU A;  3BK3 C;  3C7N B;  1HPM A;  3D2F B;  3FZK A;  2QWP A;  5AQK A;  2KGQ A;  2VY6 A;  4AEI A;  1KAX A;  5AQZ A;  2ASC A;  1GPT A;  2QWN A;  5AQS A;  4AAZ A;  5BN8 A;  1XRS B;  4HHF A;  2KJA A;  3IUC A;  1MR4 A;  2E0H A;  3KVG A;  3QI7 A;  3I33 A;  5F2R A;  3KOX A;  5EXW A;  2LY5 A;  3E7U X;  3FZL A;  4UJ0 A;  2MN5 A;  1L4V A;  2B68 A;  5EY4 A;  3C7N A;  1JXC A;  1SNB A;  2QWO A;  2YC1 C;  4H5W A;  1VNB A;  5AQP A;  2LJM A;  3KC6 A;  1NGH A;  2N2Q A;  1POI A;  1NGB A;  1T7B A;  1ZU3 A;  5F0X A;  2KHO A;  2QWL A;  1LQI A;  3QFU A;  1UGL A;  2BUP A;  1YUW A;  3KP0 A;  1GPS A;  5AQI A;  2LY6 A;  4HE7 A;  5KK4 A;  1I2U A;  2KBK A;  1AHO A;  3L6Q A;  5CY0 A;  1KAZ A;  1NGF A;  1NGE A;  2BRZ A;  3R2V A;  3KOW A;  2KPY A;  5EX5 A;  2LN8 A;  2GL1 A;  1BA0 A;  3JXU A;  1QQM A;  4GNI A;  3CW4 A;  4V1D C;  1NGA A;  5AQH A;  5AQF A;  1ZYV A;  2E2F A;  2YIP A;  2GMO A;  1CHZ A;  2D56 A;  1NPI A;  2NY9 X;  3GDQ A;  3KP1 A;  3LDN A;  2QWQ A;  5AQL A;  1DJT A;  1CN2 A;  2MBK A;  5AQG A;  1T7E A;  1BK8 A;  1DQ7 A;  5EVZ A;  1I6G A;  1KAY A;  2E3F A;  1NRA A;  2YBR C;  2G2K A;  3D2F A;  3SF4 D;  1ATS A;  1LQH A;  1ZYW A;  2KBJ A;  4FL9 A;  1ZUT A;  1PX9 A;  2SN3 A;  1T0Z A;  1PE4 A;  2ATB A;  1ZVE A;  1FH3 A;  2E88 A;  4UAD E;  1B3C A;  1P0A A;  1P00 A;  1LQQ A; 
#chains in the Genus database with same CATH homology
 1QQN A;  1HJO A;  4H5R A;  5FPM A;  3LDQ A;  1NGC A;  1BA1 A;  5AQQ A;  3QML A;  5AQW A;  1DKG D;  4H5N A;  1NGI A;  1ATR A;  5AR0 A;  4H5T A;  5AQM A;  5BPL A;  2YIO A;  5F1X A;  5FPD A;  5AQR A;  5AQV A;  2K35 A;  3KHW A;  1BUP A;  3GL1 A;  1S3X A;  5AQN A;  4IO8 A;  5FPE A;  2QWM A;  3ATV A;  3CQX A;  3FZF A;  3HSC A;  3LDL A;  3D2E B;  4UAF E;  3FZM A;  3L4I A;  5BPM A;  5AQX A;  5AQO A;  1NGJ A;  5AQY A;  5BN9 A;  5AQT A;  2QWR A;  5AQJ A;  3QFP A;  5BPN A;  2YIL A;  3LDP A;  1NGG A;  2JDQ D;  4UAE F;  3M3Z A;  2QXL A;  3AY9 A;  5FPN A;  3D2E A;  1QQO A;  1NGD A;  4HWI A;  3L56 A;  3FZH A;  2E8A A;  2V7Z A;  3FE1 A;  4H5V A;  3LDO A;  3ATU A;  1HX1 A;  2QW9 A;  3A8Y A;  4FSV A;  4KBO A;  5AQU A;  3BK3 C;  3C7N B;  1HPM A;  3D2F B;  3FZK A;  2QWP A;  5AQK A;  2VY6 A;  1KAX A;  5AQZ A;  2QWN A;  5AQS A;  5BN8 A;  3IUC A;  3KVG A;  3QI7 A;  5F2R A;  3I33 A;  5EXW A;  3FZL A;  2MN5 A;  5EY4 A;  3C7N A;  4H5W A;  2QWO A;  5AQP A;  3KC6 A;  1NGH A;  1POI A;  1NGB A;  5F0X A;  2KHO A;  2QWL A;  3QFU A;  2BUP A;  1YUW A;  5AQI A;  3L6Q A;  1KAZ A;  1NGF A;  1NGE A;  3R2V A;  5EX5 A;  2LN8 A;  1BA0 A;  3JXU A;  1QQM A;  4GNI A;  3CW4 A;  5AQH A;  1NGA A;  5AQF A;  2E2F A;  2YIP A;  2GMO A;  2D56 A;  3GDQ A;  3LDN A;  2QWQ A;  5AQL A;  2MBK A;  5AQG A;  5EVZ A;  1KAY A;  3D2F A;  3SF4 D;  1ATS A;  4FL9 A;  2E88 A;  4UAD E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...