3BK3C

Crystal structure of the complex of bmp-2 and the first von willebrand domain type c of crossveinless-2
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
67
structure length
67
Chain Sequence
WLITGTEASCENEGEVLHIPNITDNPCISCVCLNQKAECKQEKCAPLAEDCALVVKQTGACCEKCKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein 2
publication title Crystal structure analysis reveals how the Chordin family member crossveinless 2 blocks BMP-2 receptor binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 8
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.190 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 3bk3C00
2MBKA 3BK3C
chains in the Genus database with same CATH superfamily
2A7TA 1HPMA 2N66A 2QXLA 5AQMA 1XRSB 1ICAA 5FPMA 3CW4A 1SEGA 1PTXA 1HX1A 2KGQA 3C7NA 3KOYA 1MYNA 5AQSA 2B3CA 1JZBA 1MR4A 3FE1A 3HSCA 3D2FA 3ATUA 2E0HA 4FSVA 1C56A 5AR0A 2E8AA 3JXUA 1DKGD 1HJOA 1QQOA 3L6QA 1NRAA 1T1TA 1NGBA 3E7RL 3KOWA 5AQWA 4HE7A 1T7AA 1L4VA 3D2EB 1P00A 5EY4A 4AEIA 2LY5A 5BPMA 1SN4A 3BK3C 1T7EA 2KBHA 3QI7A 1QQMA 2N2RA 4AAZA 5AQUA 1PX9A 1ZYWA 2QWOA 5AQNA 1VNBA 1YUWA 4H5WA 3LDOA 5FPEA 1P0AA 1ZYVA 2E3GA 3IUCA 3GDQA 2LI7A 3L56A 1NGIA 5AQOA 3D2EA 5BN9A 1DQ7A 5F1XA 1BA0A 5FPDA 2QWMA 1BMRA 2MZ0A 1NE5A 3KHWA 1VNAA 1NPIA 2KHOA 2QWRA 3KC6A 1NGAA 4GNIA 5BN8A 1NGDA 5EX5A 4KBOA 1UGLA 3A8YA 1NGJA 1WT7A 1KAYA 1JXCA 1NGHA 2G2KA 1PE4A 4UJ0A 5AQHA 2E3FA 1JZAA 3LDPA 2ATBA 2D56A 1NH5A 1T7BA 2ASCA 5AQFA 1N4NA 5AQVA 1GPTA 3I33A 4IO8A 1ZFUA 2BRZA 2LJ7A 2NY9X 3LDLA 3QFPA 3KVGA 1K8BA 4H5NA 4UAEF 2BUPA 3CQXA 3AY9A 4H5VA 2KBJA 5AQLA 5AQZA 1OZZA 1ZUTA 2KBKA 4UADE 5AQXA 1BA1A 2GL1A 2YIOA 1I6GA 2M8BB 1TI5A 2YIPA 5AQQA 1KAXA 1BRZA 1LQQA 4UAFE 1OMYA 1GPSA 3GL1A 3KP1A 2V7ZA 1LQIA 1NGCA 3FZMA 1NGEA 2E88A 2JDQD 2SN3A 3FZLA 5AQRA 2B68A 1T0ZA 2QWLA 2LN8A 2KYQA 5EVZA 1ATSA 2I61A 2MN5A 1QQNA 1NRBA 1ATRA 1I2UA 1NGGA 2LY6A 2YILA 5AQKA 5AQPA 5KK4A 2K35A 1KV0A 1CHZA 2N2QA 1SNBA 3PSMA 3QFUA 1BK8A 4H5TA 4KYPA 1AHOA 3LDNA 2E2FA 1SN1A 4FL9A 2YEOA 3ATVA 3C7NB 3KOXA 4AB0A 5BPLA 1AYJA 1I2VA 4HWIA 2QWQA 3D2FB 3FZHA 3L4IA 5FPNA 5AQIA 3LDQA 1WWNA 3GKUA 5AQTA 5BPNA 1C55A 2QW9A 2MBKA 1NGFA 4HHFA 5F2RA 1CN2A 2KPYA 2NY8X 1BCGA 1B3CA 2KSKA 2KJAA 2VY6A 1POIA 1S3XA 5AQJA 3QMLA 3KOZA 3SF4D 2LR3A 1KAZA 3KP0A 2LT8A 3R2VA 2N69A 5AQGA 2GMOA 2LJMA 1I6FA 1DJTA 2QWNA 2YC1C 5EXWA 5F0XA 2YBRC 1ZVEA 3E7UX 3M3ZA 1FH3A 1B7DA 3FZKA 1BUPA 1LQHA 4V1DC 5CY0A 4H5RA 4CQKA 1WMTA 5AQYA 1JKZA 2QWPA 1ZVGA 1ZU3A 2LKBA 3FZFA
chains in the Genus database with same CATH topology
1HPMA 2QXLA 5AQMA 5FPMA 3CW4A 1HX1A 3C7NA 5AQSA 3HSCA 3FE1A 3D2FA 3ATUA 4FSVA 5AR0A 2E8AA 3JXUA 1DKGD 1HJOA 1QQOA 3L6QA 1NGBA 5AQWA 3D2EB 5EY4A 5BPMA 3BK3C 3QI7A 1QQMA 5AQUA 2QWOA 5AQNA 1YUWA 4H5WA 5FPEA 3LDOA 3IUCA 5BN9A 3GDQA 3L56A 5AQOA 1NGIA 3D2EA 5F1XA 1BA0A 5FPDA 2QWMA 3KHWA 2QWRA 2KHOA 3KC6A 5BN8A 1NGAA 4GNIA 1NGDA 5EX5A 4KBOA 3A8YA 1NGJA 1KAYA 1NGHA 5AQHA 3LDPA 2D56A 5AQFA 5AQVA 3I33A 4IO8A 3LDLA 3QFPA 3KVGA 4H5NA 4UAEF 2BUPA 3CQXA 3AY9A 4H5VA 5AQLA 5AQZA 5AQXA 4UADE 1BA1A 2YIOA 2YIPA 5AQQA 1KAXA 4UAFE 3GL1A 2V7ZA 3FZMA 1NGCA 1NGEA 2E88A 2JDQD 3FZLA 5AQRA 2QWLA 2LN8A 5EVZA 1ATSA 2MN5A 1QQNA 1ATRA 1NGGA 2YILA 5AQKA 5AQPA 2K35A 3QFUA 4H5TA 3LDNA 2E2FA 4FL9A 3C7NB 3ATVA 5BPLA 4HWIA 2QWQA 3D2FB 3FZHA 3L4IA 5FPNA 5AQIA 3LDQA 5BPNA 5AQTA 2QW9A 2MBKA 1NGFA 5F2RA 2VY6A 1POIA 1S3XA 5AQJA 3QMLA 3SF4D 1KAZA 3R2VA 5AQGA 2GMOA 2QWNA 5EXWA 5F0XA 3M3ZA 3FZKA 1BUPA 4H5RA 5AQYA 2QWPA 3FZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBK A;  3BK3 C; 
#chains in the Genus database with same CATH topology
 2A7T A;  1HPM A;  2N66 A;  2QXL A;  5AQM A;  1XRS B;  1ICA A;  5FPM A;  3CW4 A;  1SEG A;  1PTX A;  1HX1 A;  2KGQ A;  3C7N A;  3KOY A;  1MYN A;  5AQS A;  2B3C A;  1JZB A;  1MR4 A;  3FE1 A;  3HSC A;  3D2F A;  3ATU A;  2E0H A;  4FSV A;  1C56 A;  5AR0 A;  2E8A A;  3JXU A;  1DKG D;  1HJO A;  1QQO A;  3L6Q A;  1NRA A;  1T1T A;  1NGB A;  3E7R L;  3KOW A;  5AQW A;  4HE7 A;  1T7A A;  1L4V A;  3D2E B;  1P00 A;  5EY4 A;  4AEI A;  2LY5 A;  5BPM A;  1SN4 A;  3BK3 C;  1T7E A;  2KBH A;  3QI7 A;  1QQM A;  2N2R A;  4AAZ A;  5AQU A;  1PX9 A;  1ZYW A;  2QWO A;  5AQN A;  1VNB A;  1YUW A;  4H5W A;  3LDO A;  5FPE A;  1P0A A;  1ZYV A;  2E3G A;  3IUC A;  3GDQ A;  2LI7 A;  3L56 A;  1NGI A;  5AQO A;  3D2E A;  5BN9 A;  1DQ7 A;  5F1X A;  1BA0 A;  5FPD A;  2QWM A;  1BMR A;  2MZ0 A;  1NE5 A;  3KHW A;  1VNA A;  1NPI A;  2KHO A;  2QWR A;  3KC6 A;  1NGA A;  4GNI A;  5BN8 A;  1NGD A;  5EX5 A;  4KBO A;  1UGL A;  3A8Y A;  1NGJ A;  1WT7 A;  1KAY A;  1JXC A;  1NGH A;  2G2K A;  1PE4 A;  4UJ0 A;  5AQH A;  2E3F A;  1JZA A;  3LDP A;  2ATB A;  2D56 A;  1NH5 A;  1T7B A;  2ASC A;  5AQF A;  1N4N A;  5AQV A;  1GPT A;  3I33 A;  4IO8 A;  1ZFU A;  2BRZ A;  2LJ7 A;  2NY9 X;  3LDL A;  3QFP A;  3KVG A;  1K8B A;  4H5N A;  4UAE F;  2BUP A;  3CQX A;  3AY9 A;  4H5V A;  2KBJ A;  5AQL A;  5AQZ A;  1OZZ A;  1ZUT A;  2KBK A;  4UAD E;  5AQX A;  1BA1 A;  2GL1 A;  2YIO A;  1I6G A;  2M8B B;  1TI5 A;  2YIP A;  5AQQ A;  1KAX A;  1BRZ A;  1LQQ A;  4UAF E;  1OMY A;  1GPS A;  3GL1 A;  3KP1 A;  2V7Z A;  1LQI A;  1NGC A;  3FZM A;  1NGE A;  2E88 A;  2JDQ D;  2SN3 A;  3FZL A;  5AQR A;  2B68 A;  1T0Z A;  2QWL A;  2LN8 A;  2KYQ A;  5EVZ A;  1ATS A;  2I61 A;  2MN5 A;  1QQN A;  1NRB A;  1ATR A;  1I2U A;  1NGG A;  2LY6 A;  2YIL A;  5AQK A;  5AQP A;  5KK4 A;  2K35 A;  1KV0 A;  1CHZ A;  2N2Q A;  1SNB A;  3PSM A;  3QFU A;  1BK8 A;  4H5T A;  4KYP A;  1AHO A;  3LDN A;  2E2F A;  1SN1 A;  4FL9 A;  2YEO A;  3ATV A;  3C7N B;  3KOX A;  4AB0 A;  5BPL A;  1AYJ A;  1I2V A;  4HWI A;  2QWQ A;  3D2F B;  3FZH A;  3L4I A;  5FPN A;  5AQI A;  3LDQ A;  1WWN A;  3GKU A;  5AQT A;  5BPN A;  1C55 A;  2QW9 A;  2MBK A;  1NGF A;  4HHF A;  5F2R A;  1CN2 A;  2KPY A;  2NY8 X;  1BCG A;  1B3C A;  2KSK A;  2KJA A;  2VY6 A;  1POI A;  1S3X A;  5AQJ A;  3QML A;  3KOZ A;  3SF4 D;  2LR3 A;  1KAZ A;  3KP0 A;  2LT8 A;  3R2V A;  2N69 A;  5AQG A;  2GMO A;  2LJM A;  1I6F A;  1DJT A;  2QWN A;  2YC1 C;  5EXW A;  5F0X A;  2YBR C;  1ZVE A;  3E7U X;  3M3Z A;  1FH3 A;  1B7D A;  3FZK A;  1BUP A;  1LQH A;  4V1D C;  5CY0 A;  4H5R A;  4CQK A;  1WMT A;  5AQY A;  1JKZ A;  2QWP A;  1ZVG A;  1ZU3 A;  2LKB A;  3FZF A; 
#chains in the Genus database with same CATH homology
 1HPM A;  2QXL A;  5AQM A;  5FPM A;  3CW4 A;  1HX1 A;  3C7N A;  5AQS A;  3HSC A;  3FE1 A;  3D2F A;  3ATU A;  4FSV A;  5AR0 A;  2E8A A;  3JXU A;  1DKG D;  1HJO A;  1QQO A;  3L6Q A;  1NGB A;  5AQW A;  3D2E B;  5EY4 A;  5BPM A;  3BK3 C;  3QI7 A;  1QQM A;  5AQU A;  2QWO A;  5AQN A;  1YUW A;  4H5W A;  5FPE A;  3LDO A;  3IUC A;  5BN9 A;  3GDQ A;  3L56 A;  5AQO A;  1NGI A;  3D2E A;  5F1X A;  1BA0 A;  5FPD A;  2QWM A;  3KHW A;  2QWR A;  2KHO A;  3KC6 A;  5BN8 A;  1NGA A;  4GNI A;  1NGD A;  5EX5 A;  4KBO A;  3A8Y A;  1NGJ A;  1KAY A;  1NGH A;  5AQH A;  3LDP A;  2D56 A;  5AQF A;  5AQV A;  3I33 A;  4IO8 A;  3LDL A;  3QFP A;  3KVG A;  4H5N A;  4UAE F;  2BUP A;  3CQX A;  3AY9 A;  4H5V A;  5AQL A;  5AQZ A;  5AQX A;  4UAD E;  1BA1 A;  2YIO A;  2YIP A;  5AQQ A;  1KAX A;  4UAF E;  3GL1 A;  2V7Z A;  3FZM A;  1NGC A;  1NGE A;  2E88 A;  2JDQ D;  3FZL A;  5AQR A;  2QWL A;  2LN8 A;  5EVZ A;  1ATS A;  2MN5 A;  1QQN A;  1ATR A;  1NGG A;  2YIL A;  5AQK A;  5AQP A;  2K35 A;  3QFU A;  4H5T A;  3LDN A;  2E2F A;  4FL9 A;  3C7N B;  3ATV A;  5BPL A;  4HWI A;  2QWQ A;  3D2F B;  3FZH A;  3L4I A;  5FPN A;  5AQI A;  3LDQ A;  5BPN A;  5AQT A;  2QW9 A;  2MBK A;  1NGF A;  5F2R A;  2VY6 A;  1POI A;  1S3X A;  5AQJ A;  3QML A;  3SF4 D;  1KAZ A;  3R2V A;  5AQG A;  2GMO A;  2QWN A;  5EXW A;  5F0X A;  3M3Z A;  3FZK A;  1BUP A;  4H5R A;  5AQY A;  2QWP A;  3FZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...