3L56A

Crystal structure of the large c-terminal domain of polymerase basic protein 2 from influenza virus a/viet nam/1203/2004 (h5n1)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
202
structure length
194
Chain Sequence
NGPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLFQQMRDVLGTFDTVQIIKLLPFAAAPPKQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNKATKRLTVLGKDAGALTGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Polymerase PB2
publication title Biological and structural characterization of a host-adapting amino acid in influenza virus.
pubmed doi rcsb
source organism Influenza a virus
total genus 51
structure length 194
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 3l56A02
3L56A 4UAFE 2GMOA 3CW4A 2JDQD 3KC6A 4UAEF 4UADE 3KHWA 3R2VA 2VY6A
chains in the Genus database with same CATH superfamily
2D56A 5AQUA 4H5VA 4KBOA 4H5WA 5FPEA 2N69A 2QW9A 4UADE 5EX5A 5KK4A 1T7EA 1S3XA 1HPMA 5AQNA 1NGFA 5BN9A 1HX1A 1ZYVA 1C56A 1P00A 5CY0A 4HWIA 1L4VA 2QWLA 5AQVA 1BA0A 5F0XA 3SF4D 3JXUA 1LQQA 1XRSB 1SEGA 2NY9X 3KP0A 2LY6A 1B3CA 1I2VA 5BPLA 2N2QA 2E2FA 2A7TA 1AHOA 5BPMA 2B68A 2QWNA 5AQJA 5AQFA 1MYNA 2B3CA 2ASCA 2GL1A 2JDQD 3KOWA 3FZHA 1JZAA 1PX9A 1QQMA 2LT8A 2G2KA 3I33A 1NRBA 3IUCA 5FPDA 1K8BA 1CN2A 4AAZA 1JKZA 1SN4A 2LI7A 3C7NB 1WWNA 1ZUTA 3KC6A 5AQMA 2E3FA 2MZ0A 3AY9A 3LDQA 5AQRA 5AQSA 1BRZA 1VNBA 2KYQA 3KVGA 4CQKA 1NPIA 3LDOA 2E88A 2LJMA 3C7NA 1KAYA 4FSVA 3HSCA 1NE5A 1NGAA 1KAXA 2LKBA 2VY6A 2QWOA 1T1TA 4HE7A 5AQOA 4IO8A 1NGGA 1I2UA 3A8YA 3GKUA 5F1XA 1QQOA 2YEOA 1I6GA 1ZFUA 5AQWA 1ATRA 1BK8A 1POIA 3LDNA 3FE1A 3E7UX 1NH5A 5F2RA 1NGEA 3ATVA 2E3GA 1WT7A 5EVZA 2GMOA 4AB0A 1P0AA 1PE4A 2BUPA 1ZU3A 3CQXA 2SN3A 1LQHA 1BCGA 2BRZA 2QWRA 3D2FB 4KYPA 5AQQA 1GPSA 1NGCA 1MR4A 2K35A 2MN5A 3PSMA 2QWPA 3E7RL 1VNAA 3GL1A 5AQPA 4UAEF 2I61A 5AR0A 5AQYA 1FH3A 1ZVGA 4FL9A 1HJOA 1NGIA 1OZZA 1OMYA 1N4NA 2ATBA 4UAFE 1KAZA 3FZFA 2NY8X 1T7AA 1QQNA 4H5TA 2KJAA 5BPNA 2KBHA 3FZKA 4V1DC 2YILA 2MBKA 1KV0A 3D2EB 1NRAA 1UGLA 3QMLA 1SN1A 1PTXA 3R2VA 2QWQA 3CW4A 2YBRC 2YIPA 2E8AA 1YUWA 2KBKA 2YC1C 5AQHA 1ZVEA 5FPNA 4GNIA 4AEIA 2KSKA 2LJ7A 5AQLA 1NGJA 4HHFA 5AQIA 1BA1A 1ATSA 5AQGA 2LN8A 3LDPA 2E0HA 3D2EA 5AQZA 3QFUA 2YIOA 1C55A 2N66A 3BK3C 1DKGD 1ICAA 3M3ZA 3KHWA 2QWMA 5AQKA 4UJ0A 1JXCA 3L56A 2QXLA 3ATUA 3L6QA 5EXWA 1GPTA 3QI7A 5AQXA 3KP1A 3GDQA 1LQIA 1SNBA 1TI5A 2KPYA 1I6FA 5EY4A 4H5NA 2M8BB 1DQ7A 1DJTA 2N2RA 4H5RA 2V7ZA 3KOXA 3KOYA 5AQTA 3QFPA 1T0ZA 1NGBA 1CHZA 3D2FA 1NGHA 1NGDA 3LDLA 5BN8A 1AYJA 3KOZA 3FZMA 3L4IA 1BUPA 5FPMA 1T7BA 2LY5A 2LR3A 1WMTA 1B7DA 2KHOA 2KBJA 1JZBA 1ZYWA 2KGQA 1BMRA 3FZLA
chains in the Genus database with same CATH topology
2D56A 5AQUA 4H5VA 4KBOA 4H5WA 5FPEA 2QW9A 4UADE 5EX5A 1S3XA 1HPMA 5AQNA 1NGFA 5BN9A 1HX1A 4HWIA 2QWLA 5AQVA 1BA0A 5F0XA 3SF4D 3JXUA 5BPLA 2E2FA 5BPMA 2QWNA 5AQJA 5AQFA 2JDQD 3FZHA 1QQMA 3I33A 3IUCA 3C7NB 3KC6A 5AQMA 3AY9A 3LDQA 5AQRA 5AQSA 3KVGA 3LDOA 2E88A 3C7NA 1KAYA 4FSVA 3HSCA 1NGAA 1KAXA 2VY6A 2QWOA 5AQOA 4IO8A 1NGGA 3A8YA 5F1XA 1QQOA 5AQWA 1ATRA 1POIA 3LDNA 3FE1A 5F2RA 3ATVA 1NGEA 5EVZA 2GMOA 2BUPA 3CQXA 5AQQA 2QWRA 3D2FB 1NGCA 2K35A 2MN5A 2QWPA 3GL1A 5AQPA 5AR0A 4UAEF 5AQYA 4FL9A 1NGIA 1HJOA 4UAFE 1KAZA 3FZFA 1QQNA 4H5TA 5BPNA 5FPDA 3FZKA 2YILA 2MBKA 3D2EB 3QMLA 3R2VA 2QWQA 3CW4A 2YIPA 2E8AA 1YUWA 5AQHA 5FPNA 4GNIA 5AQLA 1NGJA 5AQIA 1BA1A 1ATSA 5AQGA 2LN8A 3LDPA 3D2EA 5AQZA 3QFUA 2YIOA 3BK3C 1DKGD 3M3ZA 3KHWA 5AQKA 3L56A 2QXLA 3ATUA 3L6QA 5EXWA 3QI7A 5AQXA 3GDQA 5EY4A 4H5NA 4H5RA 2V7ZA 5AQTA 3QFPA 1NGBA 3D2FA 1NGHA 1NGDA 3LDLA 5BN8A 3FZMA 3L4IA 1BUPA 5FPMA 2KHOA 2QWMA 3FZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L56 A;  4UAF E;  2GMO A;  3CW4 A;  2JDQ D;  3KC6 A;  4UAE F;  4UAD E;  3KHW A;  3R2V A;  2VY6 A; 
#chains in the Genus database with same CATH topology
 2D56 A;  5AQU A;  4H5V A;  4KBO A;  4H5W A;  5FPE A;  2N69 A;  2QW9 A;  4UAD E;  5EX5 A;  5KK4 A;  1T7E A;  1S3X A;  1HPM A;  5AQN A;  1NGF A;  5BN9 A;  1HX1 A;  1ZYV A;  1C56 A;  1P00 A;  5CY0 A;  4HWI A;  1L4V A;  2QWL A;  5AQV A;  1BA0 A;  5F0X A;  3SF4 D;  3JXU A;  1LQQ A;  1XRS B;  1SEG A;  2NY9 X;  3KP0 A;  2LY6 A;  1B3C A;  1I2V A;  5BPL A;  2N2Q A;  2E2F A;  2A7T A;  1AHO A;  5BPM A;  2B68 A;  2QWN A;  5AQJ A;  5AQF A;  1MYN A;  2B3C A;  2ASC A;  2GL1 A;  2JDQ D;  3KOW A;  3FZH A;  1JZA A;  1PX9 A;  1QQM A;  2LT8 A;  2G2K A;  3I33 A;  1NRB A;  3IUC A;  5FPD A;  1K8B A;  1CN2 A;  4AAZ A;  1JKZ A;  1SN4 A;  2LI7 A;  3C7N B;  1WWN A;  1ZUT A;  3KC6 A;  5AQM A;  2E3F A;  2MZ0 A;  3AY9 A;  3LDQ A;  5AQR A;  5AQS A;  1BRZ A;  1VNB A;  2KYQ A;  3KVG A;  4CQK A;  1NPI A;  3LDO A;  2E88 A;  2LJM A;  3C7N A;  1KAY A;  4FSV A;  3HSC A;  1NE5 A;  1NGA A;  1KAX A;  2LKB A;  2VY6 A;  2QWO A;  1T1T A;  4HE7 A;  5AQO A;  4IO8 A;  1NGG A;  1I2U A;  3A8Y A;  3GKU A;  5F1X A;  1QQO A;  2YEO A;  1I6G A;  1ZFU A;  5AQW A;  1ATR A;  1BK8 A;  1POI A;  3LDN A;  3FE1 A;  3E7U X;  1NH5 A;  5F2R A;  1NGE A;  3ATV A;  2E3G A;  1WT7 A;  5EVZ A;  2GMO A;  4AB0 A;  1P0A A;  1PE4 A;  2BUP A;  1ZU3 A;  3CQX A;  2SN3 A;  1LQH A;  1BCG A;  2BRZ A;  2QWR A;  3D2F B;  4KYP A;  5AQQ A;  1GPS A;  1NGC A;  1MR4 A;  2K35 A;  2MN5 A;  3PSM A;  2QWP A;  3E7R L;  1VNA A;  3GL1 A;  5AQP A;  4UAE F;  2I61 A;  5AR0 A;  5AQY A;  1FH3 A;  1ZVG A;  4FL9 A;  1HJO A;  1NGI A;  1OZZ A;  1OMY A;  1N4N A;  2ATB A;  4UAF E;  1KAZ A;  3FZF A;  2NY8 X;  1T7A A;  1QQN A;  4H5T A;  2KJA A;  5BPN A;  2KBH A;  3FZK A;  4V1D C;  2YIL A;  2MBK A;  1KV0 A;  3D2E B;  1NRA A;  1UGL A;  3QML A;  1SN1 A;  1PTX A;  3R2V A;  2QWQ A;  3CW4 A;  2YBR C;  2YIP A;  2E8A A;  1YUW A;  2KBK A;  2YC1 C;  5AQH A;  1ZVE A;  5FPN A;  4GNI A;  4AEI A;  2KSK A;  2LJ7 A;  5AQL A;  1NGJ A;  4HHF A;  5AQI A;  1BA1 A;  1ATS A;  5AQG A;  2LN8 A;  3LDP A;  2E0H A;  3D2E A;  5AQZ A;  3QFU A;  2YIO A;  1C55 A;  2N66 A;  3BK3 C;  1DKG D;  1ICA A;  3M3Z A;  3KHW A;  2QWM A;  5AQK A;  4UJ0 A;  1JXC A;  3L56 A;  2QXL A;  3ATU A;  3L6Q A;  5EXW A;  1GPT A;  3QI7 A;  5AQX A;  3KP1 A;  3GDQ A;  1LQI A;  1SNB A;  1TI5 A;  2KPY A;  1I6F A;  5EY4 A;  4H5N A;  2M8B B;  1DQ7 A;  1DJT A;  2N2R A;  4H5R A;  2V7Z A;  3KOX A;  3KOY A;  5AQT A;  3QFP A;  1T0Z A;  1NGB A;  1CHZ A;  3D2F A;  1NGH A;  1NGD A;  3LDL A;  5BN8 A;  1AYJ A;  3KOZ A;  3FZM A;  3L4I A;  1BUP A;  5FPM A;  1T7B A;  2LY5 A;  2LR3 A;  1WMT A;  1B7D A;  2KHO A;  2KBJ A;  1JZB A;  1ZYW A;  2KGQ A;  1BMR A;  3FZL A; 
#chains in the Genus database with same CATH homology
 2D56 A;  5AQU A;  4H5V A;  4KBO A;  4H5W A;  5FPE A;  2QW9 A;  4UAD E;  5EX5 A;  1S3X A;  1HPM A;  5AQN A;  1NGF A;  5BN9 A;  1HX1 A;  4HWI A;  2QWL A;  5AQV A;  1BA0 A;  5F0X A;  3SF4 D;  3JXU A;  5BPL A;  2E2F A;  5BPM A;  2QWN A;  5AQJ A;  5AQF A;  2JDQ D;  3FZH A;  1QQM A;  3I33 A;  3IUC A;  3C7N B;  3KC6 A;  5AQM A;  3AY9 A;  3LDQ A;  5AQR A;  5AQS A;  3KVG A;  3LDO A;  2E88 A;  3C7N A;  1KAY A;  4FSV A;  3HSC A;  1NGA A;  1KAX A;  2VY6 A;  2QWO A;  5AQO A;  4IO8 A;  1NGG A;  3A8Y A;  5F1X A;  1QQO A;  5AQW A;  1ATR A;  1POI A;  3LDN A;  3FE1 A;  5F2R A;  3ATV A;  1NGE A;  5EVZ A;  2GMO A;  2BUP A;  3CQX A;  5AQQ A;  2QWR A;  3D2F B;  1NGC A;  2K35 A;  2MN5 A;  2QWP A;  3GL1 A;  5AQP A;  5AR0 A;  4UAE F;  5AQY A;  4FL9 A;  1NGI A;  1HJO A;  4UAF E;  1KAZ A;  3FZF A;  1QQN A;  4H5T A;  5BPN A;  5FPD A;  3FZK A;  2YIL A;  2MBK A;  3D2E B;  3QML A;  3R2V A;  2QWQ A;  3CW4 A;  2YIP A;  2E8A A;  1YUW A;  5AQH A;  5FPN A;  4GNI A;  5AQL A;  1NGJ A;  5AQI A;  1BA1 A;  1ATS A;  5AQG A;  2LN8 A;  3LDP A;  3D2E A;  5AQZ A;  3QFU A;  2YIO A;  3BK3 C;  1DKG D;  3M3Z A;  3KHW A;  5AQK A;  3L56 A;  2QXL A;  3ATU A;  3L6Q A;  5EXW A;  3QI7 A;  5AQX A;  3GDQ A;  5EY4 A;  4H5N A;  4H5R A;  2V7Z A;  5AQT A;  3QFP A;  1NGB A;  3D2F A;  1NGH A;  1NGD A;  3LDL A;  5BN8 A;  3FZM A;  3L4I A;  1BUP A;  5FPM A;  2KHO A;  2QWM A;  3FZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...