3L56A

Crystal structure of the large c-terminal domain of polymerase basic protein 2 from influenza virus a/viet nam/1203/2004 (h5n1)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
202
structure length
194
Chain Sequence
NGPESVLVNTYQWIIRNWETVKIQWSQDPTMLYNKMEFEPFQSLVPKAARGQYSGFVRTLFQQMRDVLGTFDTVQIIKLLPFAAAPPKQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNKATKRLTVLGKDAGALTGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase PB2
publication title Biological and structural characterization of a host-adapting amino acid in influenza virus.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 51
structure length 194
sequence length 202
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 3l56A02
4UAEF 2VY6A 4UADE 3KC6A 2GMOA 4UAFE 3R2VA 3L56A 2JDQD 3CW4A 3KHWA
chains in the Genus database with same CATH superfamily
1ZUTA 1NGFA 1T0ZA 1VNBA 1P00A 2M8BB 4IO8A 5EXWA 1WMTA 4HHFA 5BPLA 5BPNA 1NGEA 1HX1A 2GMOA 4KBOA 3SF4D 5AQMA 1BRZA 5AQYA 3QFUA 5AQJA 1DKGD 1POIA 2D56A 2QWLA 2KBHA 1KAZA 3D2EB 1ICAA 5AQIA 2MBKA 1MR4A 4H5VA 4AEIA 3KOYA 1K8BA 5AQNA 5AQSA 3R2VA 2KBKA 1WWNA 5F2RA 1WT7A 1ZYWA 1UGLA 2VY6A 1C55A 2A7TA 1NGJA 2QW9A 2YILA 4H5RA 2BRZA 1KAXA 5AQOA 1BCGA 3KP1A 3L4IA 2KPYA 5AQWA 1ZYVA 3L6QA 1I2UA 5AQRA 5AQGA 1ZVEA 3LDNA 1JKZA 1ATSA 1YUWA 1KAYA 2YC1C 5AQUA 1SN1A 5AR0A 3D2FA 2KGQA 3JXUA 4H5NA 5AQTA 2NY8X 1JXCA 5EY4A 1BK8A 1CN2A 3CQXA 2ASCA 5FPMA 2LR3A 3IUCA 1PX9A 1DQ7A 2B68A 4FL9A 1SNBA 4FSVA 1AYJA 2QXLA 2LI7A 2LJ7A 5AQHA 4AAZA 3HSCA 2B3CA 1BA1A 3KP0A 1FH3A 1ATRA 1KV0A 1MYNA 1ZVGA 2E3FA 1NGGA 1NGBA 1NE5A 2N2QA 5EVZA 5F1XA 1P0AA 1T7EA 4H5WA 5AQQA 1LQIA 2LY6A 3FE1A 1OZZA 3L56A 1N4NA 2QWOA 3KVGA 2I61A 1GPSA 2BUPA 3LDQA 1LQHA 5KK4A 2QWQA 1QQMA 1NGHA 2YEOA 3FZHA 4CQKA 3C7NA 2MZ0A 2N2RA 2LJMA 4GNIA 2KBJA 2G2KA 2KSKA 5FPNA 2YIPA 3GL1A 1PE4A 3LDOA 1NRBA 3AY9A 1NGIA 3E7RL 1I2VA 5AQVA 3LDLA 1PTXA 4UJ0A 5F0XA 3D2EA 2LT8A 2KJAA 1QQNA 3M3ZA 5BN9A 2LKBA 1C56A 3KC6A 1GPTA 2N69A 2E8AA 4HWIA 5FPDA 2K35A 1VNAA 3BK3C 3GKUA 1B3CA 2E3GA 1I6GA 2NY9X 1NH5A 1T1TA 3I33A 3KOWA 4HE7A 1AHOA 2KHOA 2ATBA 1T7BA 5FPEA 2E88A 2YBRC 1HJOA 3C7NB 1TI5A 1HPMA 3D2FB 5EX5A 5AQFA 1SN4A 2GL1A 3KOXA 3FZFA 1I6FA 3PSMA 5AQXA 1NRAA 3LDPA 2YIOA 3QFPA 1DJTA 3A8YA 1QQOA 1JZAA 2LY5A 2E2FA 2KYQA 1ZU3A 2QWPA 2V7ZA 4UAFE 5AQKA 5BN8A 3ATVA 4H5TA 1JZBA 1B7DA 1T7AA 2E0HA 3KOZA 3QI7A 3QMLA 5AQPA 3ATUA 1CHZA 2QWMA 4AB0A 2SN3A 2MN5A 1NPIA 4UAEF 1S3XA 3CW4A 3KHWA 3FZLA 1LQQA 1NGDA 5BPMA 2N66A 4KYPA 3E7UX 3FZKA 2QWNA 4V1DC 1BUPA 3GDQA 1L4VA 1XRSB 1NGCA 1ZFUA 1OMYA 1NGAA 2QWRA 4UADE 1BA0A 3FZMA 5AQZA 1BMRA 5CY0A 5AQLA 1SEGA 2JDQD 2LN8A
chains in the Genus database with same CATH topology
1NGFA 4IO8A 5EXWA 5BPLA 5BPNA 1NGEA 1HX1A 2GMOA 4KBOA 3SF4D 5AQMA 5AQYA 3QFUA 5AQJA 1DKGD 1POIA 2D56A 2QWLA 3D2EB 1KAZA 5AQIA 2MBKA 4H5VA 5AQNA 5AQSA 3R2VA 5F2RA 2VY6A 1NGJA 2QW9A 2YILA 4H5RA 5AQOA 1KAXA 3L4IA 5AQWA 3L6QA 5AQRA 5AQGA 3LDNA 1ATSA 1YUWA 1KAYA 5AQUA 5AR0A 3D2FA 3JXUA 4H5NA 5AQTA 5EY4A 3CQXA 5FPMA 3IUCA 4FL9A 4FSVA 2QXLA 5AQHA 3HSCA 1BA1A 1ATRA 1NGGA 1NGBA 5EVZA 5F1XA 4H5WA 5AQQA 3FE1A 3L56A 2QWOA 3KVGA 2BUPA 3LDQA 2QWQA 1QQMA 1NGHA 3FZHA 3C7NA 4GNIA 5FPNA 2YIPA 3GL1A 3LDOA 3AY9A 1NGIA 5AQVA 3LDLA 5F0XA 3D2EA 3M3ZA 1QQNA 5BN9A 3KC6A 2E8AA 4HWIA 5FPDA 2K35A 3BK3C 3I33A 2KHOA 5FPEA 2E88A 1HJOA 3C7NB 1HPMA 3D2FB 5EX5A 5AQFA 3FZFA 5AQXA 3LDPA 2YIOA 3QFPA 3A8YA 1QQOA 2E2FA 2QWPA 2V7ZA 4UAFE 5AQKA 5BN8A 3ATVA 4H5TA 3QI7A 3QMLA 5AQPA 3ATUA 2QWMA 2MN5A 4UAEF 1S3XA 3CW4A 3KHWA 3FZLA 1NGDA 5BPMA 3FZKA 2QWNA 1BUPA 3GDQA 1NGCA 1NGAA 2QWRA 4UADE 1BA0A 3FZMA 5AQZA 5AQLA 2JDQD 2LN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UAE F;  2VY6 A;  4UAD E;  3KC6 A;  2GMO A;  4UAF E;  3R2V A;  3L56 A;  2JDQ D;  3CW4 A;  3KHW A; 
#chains in the Genus database with same CATH topology
 1ZUT A;  1NGF A;  1T0Z A;  1VNB A;  1P00 A;  2M8B B;  4IO8 A;  5EXW A;  1WMT A;  4HHF A;  5BPL A;  5BPN A;  1NGE A;  1HX1 A;  2GMO A;  4KBO A;  3SF4 D;  5AQM A;  1BRZ A;  5AQY A;  3QFU A;  5AQJ A;  1DKG D;  1POI A;  2D56 A;  2QWL A;  2KBH A;  1KAZ A;  3D2E B;  1ICA A;  5AQI A;  2MBK A;  1MR4 A;  4H5V A;  4AEI A;  3KOY A;  1K8B A;  5AQN A;  5AQS A;  3R2V A;  2KBK A;  1WWN A;  5F2R A;  1WT7 A;  1ZYW A;  1UGL A;  2VY6 A;  1C55 A;  2A7T A;  1NGJ A;  2QW9 A;  2YIL A;  4H5R A;  2BRZ A;  1KAX A;  5AQO A;  1BCG A;  3KP1 A;  3L4I A;  2KPY A;  5AQW A;  1ZYV A;  3L6Q A;  1I2U A;  5AQR A;  5AQG A;  1ZVE A;  3LDN A;  1JKZ A;  1ATS A;  1YUW A;  1KAY A;  2YC1 C;  5AQU A;  1SN1 A;  5AR0 A;  3D2F A;  2KGQ A;  3JXU A;  4H5N A;  5AQT A;  2NY8 X;  1JXC A;  5EY4 A;  1BK8 A;  1CN2 A;  3CQX A;  2ASC A;  5FPM A;  2LR3 A;  3IUC A;  1PX9 A;  1DQ7 A;  2B68 A;  4FL9 A;  1SNB A;  4FSV A;  1AYJ A;  2QXL A;  2LI7 A;  2LJ7 A;  5AQH A;  4AAZ A;  3HSC A;  2B3C A;  1BA1 A;  3KP0 A;  1FH3 A;  1ATR A;  1KV0 A;  1MYN A;  1ZVG A;  2E3F A;  1NGG A;  1NGB A;  1NE5 A;  2N2Q A;  5EVZ A;  5F1X A;  1P0A A;  1T7E A;  4H5W A;  5AQQ A;  1LQI A;  2LY6 A;  3FE1 A;  1OZZ A;  3L56 A;  1N4N A;  2QWO A;  3KVG A;  2I61 A;  1GPS A;  2BUP A;  3LDQ A;  1LQH A;  5KK4 A;  2QWQ A;  1QQM A;  1NGH A;  2YEO A;  3FZH A;  4CQK A;  3C7N A;  2MZ0 A;  2N2R A;  2LJM A;  4GNI A;  2KBJ A;  2G2K A;  2KSK A;  5FPN A;  2YIP A;  3GL1 A;  1PE4 A;  3LDO A;  1NRB A;  3AY9 A;  1NGI A;  3E7R L;  1I2V A;  5AQV A;  3LDL A;  1PTX A;  4UJ0 A;  5F0X A;  3D2E A;  2LT8 A;  2KJA A;  1QQN A;  3M3Z A;  5BN9 A;  2LKB A;  1C56 A;  3KC6 A;  1GPT A;  2N69 A;  2E8A A;  4HWI A;  5FPD A;  2K35 A;  1VNA A;  3BK3 C;  3GKU A;  1B3C A;  2E3G A;  1I6G A;  2NY9 X;  1NH5 A;  1T1T A;  3I33 A;  3KOW A;  4HE7 A;  1AHO A;  2KHO A;  2ATB A;  1T7B A;  5FPE A;  2E88 A;  2YBR C;  1HJO A;  3C7N B;  1TI5 A;  1HPM A;  3D2F B;  5EX5 A;  5AQF A;  1SN4 A;  2GL1 A;  3KOX A;  3FZF A;  1I6F A;  3PSM A;  5AQX A;  1NRA A;  3LDP A;  2YIO A;  3QFP A;  1DJT A;  3A8Y A;  1QQO A;  1JZA A;  2LY5 A;  2E2F A;  2KYQ A;  1ZU3 A;  2QWP A;  2V7Z A;  4UAF E;  5AQK A;  5BN8 A;  3ATV A;  4H5T A;  1JZB A;  1B7D A;  1T7A A;  2E0H A;  3KOZ A;  3QI7 A;  3QML A;  5AQP A;  3ATU A;  1CHZ A;  2QWM A;  4AB0 A;  2SN3 A;  2MN5 A;  1NPI A;  4UAE F;  1S3X A;  3CW4 A;  3KHW A;  3FZL A;  1LQQ A;  1NGD A;  5BPM A;  2N66 A;  4KYP A;  3E7U X;  3FZK A;  2QWN A;  4V1D C;  1BUP A;  3GDQ A;  1L4V A;  1XRS B;  1NGC A;  1ZFU A;  1OMY A;  1NGA A;  2QWR A;  4UAD E;  1BA0 A;  3FZM A;  5AQZ A;  1BMR A;  5CY0 A;  5AQL A;  1SEG A;  2JDQ D;  2LN8 A; 
#chains in the Genus database with same CATH homology
 1NGF A;  4IO8 A;  5EXW A;  5BPL A;  5BPN A;  1NGE A;  1HX1 A;  2GMO A;  4KBO A;  3SF4 D;  5AQM A;  5AQY A;  3QFU A;  5AQJ A;  1DKG D;  1POI A;  2D56 A;  2QWL A;  3D2E B;  1KAZ A;  5AQI A;  2MBK A;  4H5V A;  5AQN A;  5AQS A;  3R2V A;  5F2R A;  2VY6 A;  1NGJ A;  2QW9 A;  2YIL A;  4H5R A;  5AQO A;  1KAX A;  3L4I A;  5AQW A;  3L6Q A;  5AQR A;  5AQG A;  3LDN A;  1ATS A;  1YUW A;  1KAY A;  5AQU A;  5AR0 A;  3D2F A;  3JXU A;  4H5N A;  5AQT A;  5EY4 A;  3CQX A;  5FPM A;  3IUC A;  4FL9 A;  4FSV A;  2QXL A;  5AQH A;  3HSC A;  1BA1 A;  1ATR A;  1NGG A;  1NGB A;  5EVZ A;  5F1X A;  4H5W A;  5AQQ A;  3FE1 A;  3L56 A;  2QWO A;  3KVG A;  2BUP A;  3LDQ A;  2QWQ A;  1QQM A;  1NGH A;  3FZH A;  3C7N A;  4GNI A;  5FPN A;  2YIP A;  3GL1 A;  3LDO A;  3AY9 A;  1NGI A;  5AQV A;  3LDL A;  5F0X A;  3D2E A;  3M3Z A;  1QQN A;  5BN9 A;  3KC6 A;  2E8A A;  4HWI A;  5FPD A;  2K35 A;  3BK3 C;  3I33 A;  2KHO A;  5FPE A;  2E88 A;  1HJO A;  3C7N B;  1HPM A;  3D2F B;  5EX5 A;  5AQF A;  3FZF A;  5AQX A;  3LDP A;  2YIO A;  3QFP A;  3A8Y A;  1QQO A;  2E2F A;  2QWP A;  2V7Z A;  4UAF E;  5AQK A;  5BN8 A;  3ATV A;  4H5T A;  3QI7 A;  3QML A;  5AQP A;  3ATU A;  2QWM A;  2MN5 A;  4UAE F;  1S3X A;  3CW4 A;  3KHW A;  3FZL A;  1NGD A;  5BPM A;  3FZK A;  2QWN A;  1BUP A;  3GDQ A;  1NGC A;  1NGA A;  2QWR A;  4UAD E;  1BA0 A;  3FZM A;  5AQZ A;  5AQL A;  2JDQ D;  2LN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...