1JXCA

Minimized nmr structure of att, an arabidopsis trypsin/chymotrypsin inhibitor
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
CPEIEAQGNECLKEYGGDVGFGFCAPRIFPTICYTRCRENKGAKGGRCRWGQGSNVKCLCDFCGDTPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative trypsin inhibitor ATTI-2
publication title NMR Solution Structure of ATTp, an Arabidopsis thaliana Trypsin Inhibitor
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase inhibitor
total genus 7
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2001-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1jxcA00
2KSKA 2E3FA 2LY5A 1C56A 1JZAA 1ZUTA 5KK4A 1NRBA 1JZBA 2N66A 2YBRC 1JXCA 2B68A 1GPTA 1ZFUA 1B3CA 2ASCA 2KBJA 1NPIA 2M8BB 1L4VA 1WWNA 2KPYA 1NE5A 1BRZA 1B7DA 1CHZA 4AEIA 1JKZA 1ZYWA 1N4NA 2LR3A 1ZU3A 2B3CA 3PSMA 1I6FA 1P0AA 1MYNA 1SN4A 1FH3A 1I6GA 2GL1A 4AB0A 2LI7A 1NH5A 1BK8A 2E3GA 2NY9X 1T7EA 1DJTA 2BRZA 2YEOA 4HE7A 4CQKA 1BCGA 1T1TA 1WT7A 4V1DC 2E0HA 1LQQA 4KYPA 1LQHA 1ZVEA 2I61A 1BMRA 1TI5A 2KGQA 2A7TA 2LJ7A 1KV0A 2LJMA 4HHFA 1PE4A 1WMTA 1I2VA 2LY6A 1AYJA 2N2QA 1ZVGA 5CY0A 1CN2A 1OZZA 1LQIA 1ZYVA 2SN3A 1OMYA 1P00A 2ATBA 1GPSA 1SNBA 1NRAA 2KJAA 2KYQA 1DQ7A 1ICAA 3E7RL 2NY8X 1T7AA 1T7BA 2N69A 1SEGA 1I2UA 2YC1C 1VNAA 1AHOA 2KBKA 2MZ0A 2LT8A 3E7UX 4UJ0A 1VNBA 1MR4A 2N2RA 2KBHA 1SN1A 4AAZA 1T0ZA 1PTXA 1C55A 2LKBA 1PX9A
chains in the Genus database with same CATH superfamily
2KSKA 3GKUA 2E3FA 1BA0A 2QWQA 2LY5A 1C56A 1JZAA 1ZUTA 3M3ZA 5KK4A 3ATVA 4H5WA 1NRBA 1JZBA 4FSVA 2E8AA 3L6QA 5EY4A 1HJOA 2N66A 2YBRC 2QWLA 1JXCA 2B68A 1GPTA 5EX5A 1ZFUA 4IO8A 1NGFA 2ASCA 2KBJA 3QI7A 1B3CA 1NPIA 1YUWA 3CQXA 1ATRA 1NGEA 2M8BB 3LDOA 1L4VA 1WWNA 2KPYA 1DKGD 1BUPA 1NE5A 3CW4A 3KP0A 1B7DA 2MN5A 2YIPA 1BRZA 2QWOA 3GL1A 1UGLA 1CHZA 5BPMA 3KOWA 4AEIA 5BN9A 1JKZA 1N4NA 1ZYWA 2LR3A 1ZU3A 2B3CA 3A8YA 3L56A 3PSMA 5F2RA 1I6FA 3KOYA 1P0AA 4FL9A 3QFUA 1MYNA 2QWRA 5AQRA 1ATSA 2VY6A 1SN4A 1FH3A 3FZHA 3SF4D 3LDQA 5FPDA 1I6GA 2GL1A 5AQFA 4H5VA 4AB0A 2LI7A 3QMLA 2QW9A 1NH5A 3JXUA 3D2EA 1BK8A 2V7ZA 1XRSB 2E3GA 5AQTA 1BA1A 5AQLA 3FZFA 1NGIA 2NY9X 4H5TA 1T7EA 5AQWA 1DJTA 3D2FA 2BRZA 2YEOA 5AQJA 4HE7A 5AQMA 1KAXA 5AQIA 3HSCA 3L4IA 4CQKA 1BCGA 3FZKA 5BPNA 5F1XA 3KVGA 2D56A 1T1TA 1WT7A 2YILA 2YIOA 4H5RA 4V1DC 5AQZA 2E0HA 1LQQA 4KYPA 3KHWA 1HX1A 1LQHA 3FZMA 3I33A 4H5NA 5EVZA 1NGBA 2QWPA 2LN8A 1NGDA 1ZVEA 2I61A 4UAEF 1TI5A 2KGQA 1KAYA 1KAZA 2A7TA 3C7NA 2MBKA 1BMRA 2LJ7A 3KOXA 1KV0A 3D2EB 2LJMA 1NGJA 2GMOA 3KOZA 3KC6A 3BK3C 1NGGA 4HHFA 1K8BA 3IUCA 1PE4A 1WMTA 1I2VA 2LY6A 3ATUA 1AYJA 5AQXA 2N2QA 3QFPA 1HPMA 1ZVGA 3D2FB 5AQPA 5CY0A 1CN2A 1OZZA 2JDQD 2E2FA 3KP1A 1LQIA 1ZYVA 2QWNA 5BPLA 5AQGA 2SN3A 2KHOA 1OMYA 1P00A 5AQHA 5AQNA 5AQSA 5EXWA 1QQNA 2ATBA 1GPSA 3LDPA 3GDQA 2E88A 2QWMA 1SNBA 1NRAA 2KJAA 2KYQA 1NGCA 1DQ7A 1NGHA 4KBOA 5FPNA 1ICAA 3E7RL 2NY8X 1T7AA 1T7BA 1NGAA 2N69A 1POIA 3C7NB 1SEGA 3LDLA 1I2UA 5FPMA 2YC1C 5AQVA 5AQUA 5AR0A 1VNAA 5BN8A 1AHOA 2KBKA 2MZ0A 2G2KA 2K35A 3FZLA 5AQOA 2LT8A 5AQQA 3LDNA 3E7UX 4UJ0A 1QQOA 1VNBA 2BUPA 1MR4A 5F0XA 2N2RA 2KBHA 5FPEA 1SN1A 4AAZA 1T0ZA 5AQKA 5AQYA 1PTXA 4UAFE 1QQMA 1C55A 4GNIA 3FE1A 4UADE 4HWIA 2LKBA 1S3XA 1PX9A 3R2VA 2QXLA 3AY9A
chains in the Genus database with same CATH topology
2KSKA 2E3FA 2LY5A 1C56A 1JZAA 1ZUTA 5KK4A 1NRBA 1JZBA 2N66A 2YBRC 1JXCA 2B68A 1GPTA 1ZFUA 1B3CA 2ASCA 2KBJA 1NPIA 2M8BB 1L4VA 1WWNA 2KPYA 1NE5A 1BRZA 1B7DA 1CHZA 4AEIA 1JKZA 1ZYWA 1N4NA 2LR3A 1ZU3A 2B3CA 3PSMA 1I6FA 1P0AA 1MYNA 1SN4A 1FH3A 1I6GA 2GL1A 4AB0A 2LI7A 1NH5A 1BK8A 2E3GA 2NY9X 1T7EA 1DJTA 2BRZA 2YEOA 4HE7A 4CQKA 1BCGA 1T1TA 1WT7A 4V1DC 2E0HA 1LQQA 4KYPA 1LQHA 1ZVEA 2I61A 1BMRA 1TI5A 2KGQA 2A7TA 2LJ7A 1KV0A 2LJMA 4HHFA 1PE4A 1WMTA 1I2VA 2LY6A 1AYJA 2N2QA 1ZVGA 5CY0A 1CN2A 1OZZA 1LQIA 1ZYVA 2SN3A 1OMYA 1P00A 2ATBA 1GPSA 1SNBA 1NRAA 2KJAA 2KYQA 1DQ7A 1ICAA 3E7RL 2NY8X 1T7AA 1T7BA 2N69A 1SEGA 1I2UA 2YC1C 1VNAA 1AHOA 2KBKA 2MZ0A 2LT8A 3E7UX 4UJ0A 1VNBA 1MR4A 2N2RA 2KBHA 1SN1A 4AAZA 1T0ZA 1PTXA 1C55A 2LKBA 1PX9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSK A;  2E3F A;  2LY5 A;  1C56 A;  1JZA A;  1ZUT A;  5KK4 A;  1NRB A;  1JZB A;  2N66 A;  2YBR C;  1JXC A;  2B68 A;  1GPT A;  1ZFU A;  1B3C A;  2ASC A;  2KBJ A;  1NPI A;  2M8B B;  1L4V A;  1WWN A;  2KPY A;  1NE5 A;  1BRZ A;  1B7D A;  1CHZ A;  4AEI A;  1JKZ A;  1ZYW A;  1N4N A;  2LR3 A;  1ZU3 A;  2B3C A;  3PSM A;  1I6F A;  1P0A A;  1MYN A;  1SN4 A;  1FH3 A;  1I6G A;  2GL1 A;  4AB0 A;  2LI7 A;  1NH5 A;  1BK8 A;  2E3G A;  2NY9 X;  1T7E A;  1DJT A;  2BRZ A;  2YEO A;  4HE7 A;  4CQK A;  1BCG A;  1T1T A;  1WT7 A;  4V1D C;  2E0H A;  1LQQ A;  4KYP A;  1LQH A;  1ZVE A;  2I61 A;  1BMR A;  1TI5 A;  2KGQ A;  2A7T A;  2LJ7 A;  1KV0 A;  2LJM A;  4HHF A;  1PE4 A;  1WMT A;  1I2V A;  2LY6 A;  1AYJ A;  2N2Q A;  1ZVG A;  5CY0 A;  1CN2 A;  1OZZ A;  1LQI A;  1ZYV A;  2SN3 A;  1OMY A;  1P00 A;  2ATB A;  1GPS A;  1SNB A;  1NRA A;  2KJA A;  2KYQ A;  1DQ7 A;  1ICA A;  3E7R L;  2NY8 X;  1T7A A;  1T7B A;  2N69 A;  1SEG A;  1I2U A;  2YC1 C;  1VNA A;  1AHO A;  2KBK A;  2MZ0 A;  2LT8 A;  3E7U X;  4UJ0 A;  1VNB A;  1MR4 A;  2N2R A;  2KBH A;  1SN1 A;  4AAZ A;  1T0Z A;  1PTX A;  1C55 A;  2LKB A;  1PX9 A; 
#chains in the Genus database with same CATH topology
 2KSK A;  3GKU A;  2E3F A;  1BA0 A;  2QWQ A;  2LY5 A;  1C56 A;  1JZA A;  1ZUT A;  3M3Z A;  5KK4 A;  3ATV A;  4H5W A;  1NRB A;  1JZB A;  4FSV A;  2E8A A;  3L6Q A;  5EY4 A;  1HJO A;  2N66 A;  2YBR C;  2QWL A;  1JXC A;  2B68 A;  1GPT A;  5EX5 A;  1ZFU A;  4IO8 A;  1NGF A;  2ASC A;  2KBJ A;  3QI7 A;  1B3C A;  1NPI A;  1YUW A;  3CQX A;  1ATR A;  1NGE A;  2M8B B;  3LDO A;  1L4V A;  1WWN A;  2KPY A;  1DKG D;  1BUP A;  1NE5 A;  3CW4 A;  3KP0 A;  1B7D A;  2MN5 A;  2YIP A;  1BRZ A;  2QWO A;  3GL1 A;  1UGL A;  1CHZ A;  5BPM A;  3KOW A;  4AEI A;  5BN9 A;  1JKZ A;  1N4N A;  1ZYW A;  2LR3 A;  1ZU3 A;  2B3C A;  3A8Y A;  3L56 A;  3PSM A;  5F2R A;  1I6F A;  3KOY A;  1P0A A;  4FL9 A;  3QFU A;  1MYN A;  2QWR A;  5AQR A;  1ATS A;  2VY6 A;  1SN4 A;  1FH3 A;  3FZH A;  3SF4 D;  3LDQ A;  5FPD A;  1I6G A;  2GL1 A;  5AQF A;  4H5V A;  4AB0 A;  2LI7 A;  3QML A;  2QW9 A;  1NH5 A;  3JXU A;  3D2E A;  1BK8 A;  2V7Z A;  1XRS B;  2E3G A;  5AQT A;  1BA1 A;  5AQL A;  3FZF A;  1NGI A;  2NY9 X;  4H5T A;  1T7E A;  5AQW A;  1DJT A;  3D2F A;  2BRZ A;  2YEO A;  5AQJ A;  4HE7 A;  5AQM A;  1KAX A;  5AQI A;  3HSC A;  3L4I A;  4CQK A;  1BCG A;  3FZK A;  5BPN A;  5F1X A;  3KVG A;  2D56 A;  1T1T A;  1WT7 A;  2YIL A;  2YIO A;  4H5R A;  4V1D C;  5AQZ A;  2E0H A;  1LQQ A;  4KYP A;  3KHW A;  1HX1 A;  1LQH A;  3FZM A;  3I33 A;  4H5N A;  5EVZ A;  1NGB A;  2QWP A;  2LN8 A;  1NGD A;  1ZVE A;  2I61 A;  4UAE F;  1TI5 A;  2KGQ A;  1KAY A;  1KAZ A;  2A7T A;  3C7N A;  2MBK A;  1BMR A;  2LJ7 A;  3KOX A;  1KV0 A;  3D2E B;  2LJM A;  1NGJ A;  2GMO A;  3KOZ A;  3KC6 A;  3BK3 C;  1NGG A;  4HHF A;  1K8B A;  3IUC A;  1PE4 A;  1WMT A;  1I2V A;  2LY6 A;  3ATU A;  1AYJ A;  5AQX A;  2N2Q A;  3QFP A;  1HPM A;  1ZVG A;  3D2F B;  5AQP A;  5CY0 A;  1CN2 A;  1OZZ A;  2JDQ D;  2E2F A;  3KP1 A;  1LQI A;  1ZYV A;  2QWN A;  5BPL A;  5AQG A;  2SN3 A;  2KHO A;  1OMY A;  1P00 A;  5AQH A;  5AQN A;  5AQS A;  5EXW A;  1QQN A;  2ATB A;  1GPS A;  3LDP A;  3GDQ A;  2E88 A;  2QWM A;  1SNB A;  1NRA A;  2KJA A;  2KYQ A;  1NGC A;  1DQ7 A;  1NGH A;  4KBO A;  5FPN A;  1ICA A;  3E7R L;  2NY8 X;  1T7A A;  1T7B A;  1NGA A;  2N69 A;  1POI A;  3C7N B;  1SEG A;  3LDL A;  1I2U A;  5FPM A;  2YC1 C;  5AQV A;  5AQU A;  5AR0 A;  1VNA A;  5BN8 A;  1AHO A;  2KBK A;  2MZ0 A;  2G2K A;  2K35 A;  3FZL A;  5AQO A;  2LT8 A;  5AQQ A;  3LDN A;  3E7U X;  4UJ0 A;  1QQO A;  1VNB A;  2BUP A;  1MR4 A;  5F0X A;  2N2R A;  2KBH A;  5FPE A;  1SN1 A;  4AAZ A;  1T0Z A;  5AQK A;  5AQY A;  1PTX A;  4UAF E;  1QQM A;  1C55 A;  4GNI A;  3FE1 A;  4UAD E;  4HWI A;  2LKB A;  1S3X A;  1PX9 A;  3R2V A;  2QXL A;  3AY9 A; 
#chains in the Genus database with same CATH homology
 2KSK A;  2E3F A;  2LY5 A;  1C56 A;  1JZA A;  1ZUT A;  5KK4 A;  1NRB A;  1JZB A;  2N66 A;  2YBR C;  1JXC A;  2B68 A;  1GPT A;  1ZFU A;  1B3C A;  2ASC A;  2KBJ A;  1NPI A;  2M8B B;  1L4V A;  1WWN A;  2KPY A;  1NE5 A;  1BRZ A;  1B7D A;  1CHZ A;  4AEI A;  1JKZ A;  1ZYW A;  1N4N A;  2LR3 A;  1ZU3 A;  2B3C A;  3PSM A;  1I6F A;  1P0A A;  1MYN A;  1SN4 A;  1FH3 A;  1I6G A;  2GL1 A;  4AB0 A;  2LI7 A;  1NH5 A;  1BK8 A;  2E3G A;  2NY9 X;  1T7E A;  1DJT A;  2BRZ A;  2YEO A;  4HE7 A;  4CQK A;  1BCG A;  1T1T A;  1WT7 A;  4V1D C;  2E0H A;  1LQQ A;  4KYP A;  1LQH A;  1ZVE A;  2I61 A;  1BMR A;  1TI5 A;  2KGQ A;  2A7T A;  2LJ7 A;  1KV0 A;  2LJM A;  4HHF A;  1PE4 A;  1WMT A;  1I2V A;  2LY6 A;  1AYJ A;  2N2Q A;  1ZVG A;  5CY0 A;  1CN2 A;  1OZZ A;  1LQI A;  1ZYV A;  2SN3 A;  1OMY A;  1P00 A;  2ATB A;  1GPS A;  1SNB A;  1NRA A;  2KJA A;  2KYQ A;  1DQ7 A;  1ICA A;  3E7R L;  2NY8 X;  1T7A A;  1T7B A;  2N69 A;  1SEG A;  1I2U A;  2YC1 C;  1VNA A;  1AHO A;  2KBK A;  2MZ0 A;  2LT8 A;  3E7U X;  4UJ0 A;  1VNB A;  1MR4 A;  2N2R A;  2KBH A;  1SN1 A;  4AAZ A;  1T0Z A;  1PTX A;  1C55 A;  2LKB A;  1PX9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...