1JXCA

Minimized nmr structure of att, an arabidopsis trypsin/chymotrypsin inhibitor
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
b'CPEIEAQGNECLKEYGGDVGFGFCAPRIFPTICYTRCRENKGAKGGRCRWGQGSNVKCLCDFCGDTPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative trypsin inhibitor ATTI-2
publication title NMR Solution Structure of ATTp, an Arabidopsis thaliana Trypsin Inhibitor
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase inhibitor
total genus 7
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2001-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1jxcA00
1SN4A 1GPTA 1ZVEA 1P00A 2N66A 1B3CA 3PSMA 4KYPA 5CY0A 1SEGA 2E0HA 2ASCA 2KGQA 1WT7A 1T7AA 4V1DC 4AB0A 1T1TA 2KJAA 2LT8A 2B68A 1C56A 1ZYWA 1JKZA 1I2VA 2KBKA 2LR3A 4AAZA 2KBHA 2LKBA 4UJ0A 2LY5A 1BCGA 2N2QA 1NRAA 2NY8X 1FH3A 2YBRC 2GL1A 2I61A 1PTXA 4AEIA 1MYNA 1T7EA 4HHFA 1VNAA 1T0ZA 1P0AA 1ZFUA 1NPIA 1ZYVA 1NRBA 1AYJA 4CQKA 1CN2A 1PX9A 1CHZA 1ZVGA 2YC1C 3E7RL 1JZBA 2KYQA 2LJMA 1SNBA 1JZAA 1AHOA 1L4VA 2KBJA 2N2RA 1BMRA 1KV0A 1WWNA 2B3CA 1SN1A 1NH5A 2ATBA 1JXCA 1I2UA 1LQIA 1ZUTA 2BRZA 2SN3A 1VNBA 2M8BB 1I6GA 1DQ7A 1B7DA 2LY6A 5KK4A 2LI7A 1LQHA 1OMYA 1PE4A 2LJ7A 2N69A 1MR4A 2KSKA 1T7BA 1ZU3A 2KPYA 1LQQA 1NE5A 3E7UX 2NY9X 1TI5A 2E3GA 1BK8A 1BRZA 2YEOA 2E3FA 4HE7A 1WMTA 1DJTA 1I6FA 1N4NA 1GPSA 2MZ0A 1ICAA 1OZZA 1C55A 2A7TA
chains in the Genus database with same CATH superfamily
1SN4A 1GPTA 2E88A 2QW9A 1NGHA 3M3ZA 3CW4A 1ZVEA 1P00A 4GNIA 2BUPA 3KP1A 4UADE 1HJOA 2N66A 1ATSA 5F2RA 4UJ0A 1B3CA 3PSMA 5AQVA 5EXWA 3AY9A 4KYPA 5CY0A 1DKGD 4H5RA 5AQTA 1SEGA 2MBKA 2E0HA 2ASCA 2KGQA 3FZFA 3FZLA 1WT7A 4UAFE 5AQQA 1T7AA 1BUPA 4V1DC 5BPMA 4H5TA 5FPDA 4AB0A 5EX5A 3KOXA 1HX1A 1T1TA 3LDNA 2KJAA 2QWMA 5F0XA 3ATUA 5AQUA 2LT8A 2B68A 1C56A 1NGIA 1ZYWA 5AQLA 1JKZA 3JXUA 1I2VA 5AR0A 1NGEA 3QMLA 3C7NA 2QXLA 2KBKA 1KAYA 1NGBA 2LR3A 5AQKA 4AAZA 5AQGA 2KBHA 3HSCA 5BPLA 2LKBA 3LDLA 2LY5A 4FSVA 3A8YA 3GL1A 5EY4A 1BCGA 2N2QA 3CQXA 1NRAA 2NY8X 1FH3A 2YBRC 2GL1A 2KHOA 2I61A 1PTXA 3GDQA 5AQZA 3FZKA 3KOWA 4FL9A 4AEIA 5AQSA 1MYNA 2GMOA 5FPEA 1T7EA 1S3XA 4HHFA 1VNAA 1T0ZA 1P0AA 1ZFUA 1NPIA 1XRSB 4HWIA 5AQOA 1ZYVA 1NRBA 1AYJA 3FZHA 2YILA 4CQKA 1CN2A 1KAXA 1PX9A 1CHZA 4IO8A 1ZVGA 1NGJA 2YC1C 2LN8A 3L6QA 3E7RL 1JZBA 2KYQA 2LJMA 1SNBA 2JDQD 4H5WA 1JZAA 1AHOA 3KOYA 3C7NB 5BPNA 3KOZA 3IUCA 1L4VA 2E8AA 5AQFA 2KBJA 3D2FA 4H5VA 2N2RA 1BA0A 1NGDA 2MN5A 3SF4D 1BMRA 5BN9A 3ATVA 1KV0A 1POIA 2QWLA 1WWNA 1KAZA 1ATRA 1NGAA 3FE1A 2B3CA 3R2VA 1SN1A 1NH5A 4H5NA 4KBOA 2ATBA 1JXCA 1I2UA 5AQPA 3BK3C 1LQIA 5AQHA 1ZUTA 2BRZA 3D2EA 3D2EB 2SN3A 5AQYA 1VNBA 1YUWA 2M8BB 1I6GA 3L4IA 1DQ7A 1B7DA 3KP0A 2QWQA 2LY6A 5AQNA 2LI7A 3FZMA 1QQMA 2YIOA 3KC6A 5KK4A 1NGFA 1LQHA 1OMYA 2VY6A 1QQNA 1PE4A 2LJ7A 2E2FA 3D2FB 5F1XA 2K35A 2G2KA 2N69A 1MR4A 1UGLA 2KSKA 4UAEF 5AQMA 5AQWA 3GKUA 1T7BA 1ZU3A 3KHWA 1HPMA 1LQQA 2KPYA 5AQJA 1NE5A 2QWNA 3E7UX 2NY9X 1TI5A 2E3GA 1BA1A 1BK8A 5EVZA 5BN8A 1BRZA 2QWRA 3L56A 2YEOA 2E3FA 3QFPA 5FPNA 2QWPA 3LDPA 4HE7A 5FPMA 1WMTA 5AQRA 2YIPA 5AQIA 2V7ZA 3I33A 1DJTA 1NGGA 1I6FA 1N4NA 2D56A 3QI7A 1GPSA 1K8BA 3LDQA 2MZ0A 5AQXA 1OZZA 1ICAA 2QWOA 1NGCA 2A7TA 1C55A 3LDOA 3QFUA 3KVGA 1QQOA
chains in the Genus database with same CATH topology
1SN4A 1GPTA 1ZVEA 1P00A 2N66A 1B3CA 3PSMA 4KYPA 5CY0A 1SEGA 2E0HA 2ASCA 2KGQA 1WT7A 1T7AA 4V1DC 4AB0A 1T1TA 2KJAA 2LT8A 2B68A 1C56A 1ZYWA 1JKZA 1I2VA 2KBKA 2LR3A 4AAZA 2KBHA 2LKBA 4UJ0A 2LY5A 1BCGA 2N2QA 1NRAA 2NY8X 1FH3A 2YBRC 2GL1A 2I61A 1PTXA 4AEIA 1MYNA 1T7EA 4HHFA 1VNAA 1T0ZA 1P0AA 1ZFUA 1NPIA 1ZYVA 1NRBA 1AYJA 4CQKA 1CN2A 1PX9A 1CHZA 1ZVGA 2YC1C 3E7RL 1JZBA 2KYQA 2LJMA 1SNBA 1JZAA 1AHOA 1L4VA 2KBJA 2N2RA 1BMRA 1KV0A 1WWNA 2B3CA 1SN1A 1NH5A 2ATBA 1JXCA 1I2UA 1LQIA 1ZUTA 2BRZA 2SN3A 1VNBA 2M8BB 1I6GA 1DQ7A 1B7DA 2LY6A 5KK4A 2LI7A 1LQHA 1OMYA 1PE4A 2LJ7A 2N69A 1MR4A 2KSKA 1T7BA 1ZU3A 2KPYA 1LQQA 1NE5A 3E7UX 2NY9X 1TI5A 2E3GA 1BK8A 1BRZA 2YEOA 2E3FA 4HE7A 1WMTA 1DJTA 1I6FA 1N4NA 1GPSA 2MZ0A 1ICAA 1OZZA 1C55A 2A7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SN4 A;  1GPT A;  1ZVE A;  1P00 A;  2N66 A;  1B3C A;  3PSM A;  4KYP A;  5CY0 A;  1SEG A;  2E0H A;  2ASC A;  2KGQ A;  1WT7 A;  1T7A A;  4V1D C;  4AB0 A;  1T1T A;  2KJA A;  2LT8 A;  2B68 A;  1C56 A;  1ZYW A;  1JKZ A;  1I2V A;  2KBK A;  2LR3 A;  4AAZ A;  2KBH A;  2LKB A;  4UJ0 A;  2LY5 A;  1BCG A;  2N2Q A;  1NRA A;  2NY8 X;  1FH3 A;  2YBR C;  2GL1 A;  2I61 A;  1PTX A;  4AEI A;  1MYN A;  1T7E A;  4HHF A;  1VNA A;  1T0Z A;  1P0A A;  1ZFU A;  1NPI A;  1ZYV A;  1NRB A;  1AYJ A;  4CQK A;  1CN2 A;  1PX9 A;  1CHZ A;  1ZVG A;  2YC1 C;  3E7R L;  1JZB A;  2KYQ A;  2LJM A;  1SNB A;  1JZA A;  1AHO A;  1L4V A;  2KBJ A;  2N2R A;  1BMR A;  1KV0 A;  1WWN A;  2B3C A;  1SN1 A;  1NH5 A;  2ATB A;  1JXC A;  1I2U A;  1LQI A;  1ZUT A;  2BRZ A;  2SN3 A;  1VNB A;  2M8B B;  1I6G A;  1DQ7 A;  1B7D A;  2LY6 A;  5KK4 A;  2LI7 A;  1LQH A;  1OMY A;  1PE4 A;  2LJ7 A;  2N69 A;  1MR4 A;  2KSK A;  1T7B A;  1ZU3 A;  2KPY A;  1LQQ A;  1NE5 A;  3E7U X;  2NY9 X;  1TI5 A;  2E3G A;  1BK8 A;  1BRZ A;  2YEO A;  2E3F A;  4HE7 A;  1WMT A;  1DJT A;  1I6F A;  1N4N A;  1GPS A;  2MZ0 A;  1ICA A;  1OZZ A;  1C55 A;  2A7T A; 
#chains in the Genus database with same CATH topology
 1SN4 A;  1GPT A;  2E88 A;  2QW9 A;  1NGH A;  3M3Z A;  3CW4 A;  1ZVE A;  1P00 A;  4GNI A;  2BUP A;  3KP1 A;  4UAD E;  1HJO A;  2N66 A;  1ATS A;  5F2R A;  4UJ0 A;  1B3C A;  3PSM A;  5AQV A;  5EXW A;  3AY9 A;  4KYP A;  5CY0 A;  1DKG D;  4H5R A;  5AQT A;  1SEG A;  2MBK A;  2E0H A;  2ASC A;  2KGQ A;  3FZF A;  3FZL A;  1WT7 A;  4UAF E;  5AQQ A;  1T7A A;  1BUP A;  4V1D C;  5BPM A;  4H5T A;  5FPD A;  4AB0 A;  5EX5 A;  3KOX A;  1HX1 A;  1T1T A;  3LDN A;  2KJA A;  2QWM A;  5F0X A;  3ATU A;  5AQU A;  2LT8 A;  2B68 A;  1C56 A;  1NGI A;  1ZYW A;  5AQL A;  1JKZ A;  3JXU A;  1I2V A;  5AR0 A;  1NGE A;  3QML A;  3C7N A;  2QXL A;  2KBK A;  1KAY A;  1NGB A;  2LR3 A;  5AQK A;  4AAZ A;  5AQG A;  2KBH A;  3HSC A;  5BPL A;  2LKB A;  3LDL A;  2LY5 A;  4FSV A;  3A8Y A;  3GL1 A;  5EY4 A;  1BCG A;  2N2Q A;  3CQX A;  1NRA A;  2NY8 X;  1FH3 A;  2YBR C;  2GL1 A;  2KHO A;  2I61 A;  1PTX A;  3GDQ A;  5AQZ A;  3FZK A;  3KOW A;  4FL9 A;  4AEI A;  5AQS A;  1MYN A;  2GMO A;  5FPE A;  1T7E A;  1S3X A;  4HHF A;  1VNA A;  1T0Z A;  1P0A A;  1ZFU A;  1NPI A;  1XRS B;  4HWI A;  5AQO A;  1ZYV A;  1NRB A;  1AYJ A;  3FZH A;  2YIL A;  4CQK A;  1CN2 A;  1KAX A;  1PX9 A;  1CHZ A;  4IO8 A;  1ZVG A;  1NGJ A;  2YC1 C;  2LN8 A;  3L6Q A;  3E7R L;  1JZB A;  2KYQ A;  2LJM A;  1SNB A;  2JDQ D;  4H5W A;  1JZA A;  1AHO A;  3KOY A;  3C7N B;  5BPN A;  3KOZ A;  3IUC A;  1L4V A;  2E8A A;  5AQF A;  2KBJ A;  3D2F A;  4H5V A;  2N2R A;  1BA0 A;  1NGD A;  2MN5 A;  3SF4 D;  1BMR A;  5BN9 A;  3ATV A;  1KV0 A;  1POI A;  2QWL A;  1WWN A;  1KAZ A;  1ATR A;  1NGA A;  3FE1 A;  2B3C A;  3R2V A;  1SN1 A;  1NH5 A;  4H5N A;  4KBO A;  2ATB A;  1JXC A;  1I2U A;  5AQP A;  3BK3 C;  1LQI A;  5AQH A;  1ZUT A;  2BRZ A;  3D2E A;  3D2E B;  2SN3 A;  5AQY A;  1VNB A;  1YUW A;  2M8B B;  1I6G A;  3L4I A;  1DQ7 A;  1B7D A;  3KP0 A;  2QWQ A;  2LY6 A;  5AQN A;  2LI7 A;  3FZM A;  1QQM A;  2YIO A;  3KC6 A;  5KK4 A;  1NGF A;  1LQH A;  1OMY A;  2VY6 A;  1QQN A;  1PE4 A;  2LJ7 A;  2E2F A;  3D2F B;  5F1X A;  2K35 A;  2G2K A;  2N69 A;  1MR4 A;  1UGL A;  2KSK A;  4UAE F;  5AQM A;  5AQW A;  3GKU A;  1T7B A;  1ZU3 A;  3KHW A;  1HPM A;  1LQQ A;  2KPY A;  5AQJ A;  1NE5 A;  2QWN A;  3E7U X;  2NY9 X;  1TI5 A;  2E3G A;  1BA1 A;  1BK8 A;  5EVZ A;  5BN8 A;  1BRZ A;  2QWR A;  3L56 A;  2YEO A;  2E3F A;  3QFP A;  5FPN A;  2QWP A;  3LDP A;  4HE7 A;  5FPM A;  1WMT A;  5AQR A;  2YIP A;  5AQI A;  2V7Z A;  3I33 A;  1DJT A;  1NGG A;  1I6F A;  1N4N A;  2D56 A;  3QI7 A;  1GPS A;  1K8B A;  3LDQ A;  2MZ0 A;  5AQX A;  1OZZ A;  1ICA A;  2QWO A;  1NGC A;  2A7T A;  1C55 A;  3LDO A;  3QFU A;  3KVG A;  1QQO A; 
#chains in the Genus database with same CATH homology
 1SN4 A;  1GPT A;  1ZVE A;  1P00 A;  2N66 A;  1B3C A;  3PSM A;  4KYP A;  5CY0 A;  1SEG A;  2E0H A;  2ASC A;  2KGQ A;  1WT7 A;  1T7A A;  4V1D C;  4AB0 A;  1T1T A;  2KJA A;  2LT8 A;  2B68 A;  1C56 A;  1ZYW A;  1JKZ A;  1I2V A;  2KBK A;  2LR3 A;  4AAZ A;  2KBH A;  2LKB A;  4UJ0 A;  2LY5 A;  1BCG A;  2N2Q A;  1NRA A;  2NY8 X;  1FH3 A;  2YBR C;  2GL1 A;  2I61 A;  1PTX A;  4AEI A;  1MYN A;  1T7E A;  4HHF A;  1VNA A;  1T0Z A;  1P0A A;  1ZFU A;  1NPI A;  1ZYV A;  1NRB A;  1AYJ A;  4CQK A;  1CN2 A;  1PX9 A;  1CHZ A;  1ZVG A;  2YC1 C;  3E7R L;  1JZB A;  2KYQ A;  2LJM A;  1SNB A;  1JZA A;  1AHO A;  1L4V A;  2KBJ A;  2N2R A;  1BMR A;  1KV0 A;  1WWN A;  2B3C A;  1SN1 A;  1NH5 A;  2ATB A;  1JXC A;  1I2U A;  1LQI A;  1ZUT A;  2BRZ A;  2SN3 A;  1VNB A;  2M8B B;  1I6G A;  1DQ7 A;  1B7D A;  2LY6 A;  5KK4 A;  2LI7 A;  1LQH A;  1OMY A;  1PE4 A;  2LJ7 A;  2N69 A;  1MR4 A;  2KSK A;  1T7B A;  1ZU3 A;  2KPY A;  1LQQ A;  1NE5 A;  3E7U X;  2NY9 X;  1TI5 A;  2E3G A;  1BK8 A;  1BRZ A;  2YEO A;  2E3F A;  4HE7 A;  1WMT A;  1DJT A;  1I6F A;  1N4N A;  1GPS A;  2MZ0 A;  1ICA A;  1OZZ A;  1C55 A;  2A7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...