1JXCA

Minimized nmr structure of att, an arabidopsis trypsin/chymotrypsin inhibitor
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
68
structure length
68
Chain Sequence
CPEIEAQGNECLKEYGGDVGFGFCAPRIFPTICYTRCRENKGAKGGRCRWGQGSNVKCLCDFCGDTPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution Structure of ATTp, an Arabidopsis thaliana Trypsin Inhibitor
pubmed doi rcsb
molecule keywords Putative trypsin inhibitor ATTI-2
molecule tags Hydrolase inhibitor
source organism Arabidopsis thaliana
total genus 7
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2001-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1jxcA00
1PE4A 4AEIA 1B7DA 4AAZA 4AB0A 2GL1A 2YC1C 1OMYA 1ZU3A 2N69A 1NH5A 1BCGA 1NRAA 2KBKA 1I6FA 1NPIA 2BRZA 1LQIA 1ZVGA 1T1TA 1JXCA 1ZFUA 1LQQA 1ZYWA 1MR4A 2KBJA 1AHOA 2ATBA 2YBRC 1BK8A 1PTXA 1T7AA 2N2QA 1DQ7A 1L4VA 1T0ZA 2B3CA 4CQKA 2SN3A 1ICAA 2A7TA 4V1DC 2LJMA 1BRZA 1I6GA 1KV0A 2NY9X 2KPYA 1TI5A 2LJ7A 1SEGA 4KYPA 1T7EA 2LR3A 2I61A 1ZVEA 1I2UA 3E7RL 1NRBA 1SNBA 1C55A 1NE5A 1ZUTA 1GPSA 1CHZA 1AYJA 1JZBA 1P00A 5CY0A 1T7BA 1B3CA 2KJAA 4HE7A 1N4NA 2KBHA 2LI7A 1I2VA 2LY5A 2N2RA 1ZYVA 2KSKA 2LY6A 1GPTA 2LKBA 2MZ0A 2ASCA 1LQHA 2N66A 1BMRA 1WWNA 1PX9A 1P0AA 1WT7A 1VNAA 2M8BB 1JKZA 1SN4A 4HHFA 1SN1A 2LT8A 1DJTA 2YEOA 4UJ0A 2NY8X 2KYQA 1OZZA 3PSMA 5KK4A 2E0HA 3E7UX 1MYNA 1JZAA 2B68A 1C56A 2E3FA 1WMTA 1CN2A 2E3GA 1FH3A 2KGQA 1VNBA
chains in the Genus database with same CATH superfamily
1PE4A 4AEIA 1B7DA 3CQXA 4AAZA 5AQQA 4AB0A 2GL1A 2YC1C 1OMYA 1NGDA 1ZU3A 2E8AA 3R2VA 2N69A 2MBKA 1NH5A 1BCGA 1BA1A 5FPDA 1NRAA 4H5RA 2KBKA 3I33A 1I6FA 4HWIA 3IUCA 1KAXA 1NPIA 2BRZA 1NGAA 1NGJA 1LQIA 2VY6A 1QQOA 3C7NB 3FZMA 1S3XA 1ZVGA 1T1TA 1NGFA 1JXCA 1ZFUA 3GL1A 1NGHA 1LQQA 1ATSA 4H5TA 5AQNA 5AQLA 1ZYWA 1MR4A 3FZKA 3KHWA 3LDQA 5F1XA 2KBJA 1AHOA 1KAZA 3KP0A 2ATBA 2D56A 2YBRC 1BK8A 1BA0A 1PTXA 1T7AA 3LDOA 4FSVA 3FZFA 2N2QA 4H5WA 3QFUA 5AQJA 3D2FA 1K8BA 1DQ7A 5F2RA 1L4VA 3KVGA 1T0ZA 2B3CA 3A8YA 1ATRA 4CQKA 2E2FA 2SN3A 2KHOA 5FPEA 2MN5A 1ICAA 2A7TA 4V1DC 1NGIA 5AQTA 3AY9A 4UAEF 1QQMA 2LJMA 3LDNA 2QWPA 4GNIA 5F0XA 1BRZA 1XRSB 1DKGD 5AQGA 5BPLA 3QMLA 3KOZA 3KOYA 3QI7A 4KBOA 5AQHA 1I6GA 1KV0A 2NY9X 5AQVA 2KPYA 1TI5A 2LJ7A 1HX1A 2E88A 1SEGA 5AQSA 5EY4A 5AQRA 3D2FB 1KAYA 1HPMA 1T7EA 2I61A 2LR3A 4KYPA 1ZVEA 1I2UA 3HSCA 3E7RL 3JXUA 1NRBA 5AQZA 1HJOA 5AQPA 5BN9A 1SNBA 1C55A 1NE5A 1ZUTA 1UGLA 2BUPA 1GPSA 1CHZA 4FL9A 5AQMA 1AYJA 5FPNA 3FZHA 2K35A 5AQXA 1BUPA 1JZBA 1P00A 5BPNA 2QXLA 5CY0A 2YIPA 1T7BA 5FPMA 1B3CA 2KJAA 4HE7A 1N4NA 2YILA 2KBHA 2LI7A 1NGCA 3GDQA 2G2KA 1I2VA 4H5VA 2LY5A 1NGEA 5AQYA 2N2RA 1ZYVA 3L56A 5AQKA 2KSKA 2LY6A 1GPTA 5AQOA 3L6QA 3ATVA 2LKBA 2MZ0A 2ASCA 1LQHA 2N66A 3FE1A 1BMRA 3KOXA 1YUWA 3BK3C 2JDQD 3D2EA 1WWNA 3KP1A 3QFPA 1PX9A 2LN8A 1P0AA 1WT7A 5AQFA 1VNAA 5BPMA 2M8BB 4H5NA 2V7ZA 3FZLA 2QWNA 3CW4A 2QWQA 1JKZA 1SN4A 3ATUA 4HHFA 5AQWA 1SN1A 2LT8A 1DJTA 2YEOA 3LDLA 3LDPA 3M3ZA 4UJ0A 3GKUA 5AQIA 2NY8X 1NGGA 4UAFE 5AQUA 3SF4D 5BN8A 2QWRA 2KYQA 1OZZA 1NGBA 5EXWA 3PSMA 5KK4A 2E0HA 3E7UX 2QW9A 1MYNA 1JZAA 2B68A 3D2EB 1C56A 3KC6A 2GMOA 2YIOA 2E3FA 3KOWA 3L4IA 2QWOA 1QQNA 4UADE 4IO8A 3C7NA 2QWLA 5EX5A 1WMTA 2QWMA 1CN2A 5EVZA 2E3GA 1FH3A 2KGQA 1VNBA 1POIA 5AR0A
chains in the Genus database with same CATH topology
1PE4A 4AEIA 1B7DA 4AAZA 4AB0A 2GL1A 2YC1C 1OMYA 1ZU3A 2N69A 1NH5A 1BCGA 1NRAA 2KBKA 1I6FA 1NPIA 2BRZA 1LQIA 1ZVGA 1T1TA 1JXCA 1ZFUA 1LQQA 1ZYWA 1MR4A 2KBJA 1AHOA 2ATBA 2YBRC 1BK8A 1PTXA 1T7AA 2N2QA 1DQ7A 1L4VA 1T0ZA 2B3CA 4CQKA 2SN3A 1ICAA 2A7TA 4V1DC 2LJMA 1BRZA 1I6GA 1KV0A 2NY9X 2KPYA 1TI5A 2LJ7A 1SEGA 4KYPA 1T7EA 2LR3A 2I61A 1ZVEA 1I2UA 3E7RL 1NRBA 1SNBA 1C55A 1NE5A 1ZUTA 1GPSA 1CHZA 1AYJA 1JZBA 1P00A 5CY0A 1T7BA 1B3CA 2KJAA 4HE7A 1N4NA 2KBHA 2LI7A 1I2VA 2LY5A 2N2RA 1ZYVA 2KSKA 2LY6A 1GPTA 2LKBA 2MZ0A 2ASCA 1LQHA 2N66A 1BMRA 1WWNA 1PX9A 1P0AA 1WT7A 1VNAA 2M8BB 1JKZA 1SN4A 4HHFA 1SN1A 2LT8A 1DJTA 2YEOA 4UJ0A 2NY8X 2KYQA 1OZZA 3PSMA 5KK4A 2E0HA 3E7UX 1MYNA 1JZAA 2B68A 1C56A 2E3FA 1WMTA 1CN2A 2E3GA 1FH3A 2KGQA 1VNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PE4 A;  4AEI A;  1B7D A;  4AAZ A;  4AB0 A;  2GL1 A;  2YC1 C;  1OMY A;  1ZU3 A;  2N69 A;  1NH5 A;  1BCG A;  1NRA A;  2KBK A;  1I6F A;  1NPI A;  2BRZ A;  1LQI A;  1ZVG A;  1T1T A;  1JXC A;  1ZFU A;  1LQQ A;  1ZYW A;  1MR4 A;  2KBJ A;  1AHO A;  2ATB A;  2YBR C;  1BK8 A;  1PTX A;  1T7A A;  2N2Q A;  1DQ7 A;  1L4V A;  1T0Z A;  2B3C A;  4CQK A;  2SN3 A;  1ICA A;  2A7T A;  4V1D C;  2LJM A;  1BRZ A;  1I6G A;  1KV0 A;  2NY9 X;  2KPY A;  1TI5 A;  2LJ7 A;  1SEG A;  4KYP A;  1T7E A;  2LR3 A;  2I61 A;  1ZVE A;  1I2U A;  3E7R L;  1NRB A;  1SNB A;  1C55 A;  1NE5 A;  1ZUT A;  1GPS A;  1CHZ A;  1AYJ A;  1JZB A;  1P00 A;  5CY0 A;  1T7B A;  1B3C A;  2KJA A;  4HE7 A;  1N4N A;  2KBH A;  2LI7 A;  1I2V A;  2LY5 A;  2N2R A;  1ZYV A;  2KSK A;  2LY6 A;  1GPT A;  2LKB A;  2MZ0 A;  2ASC A;  1LQH A;  2N66 A;  1BMR A;  1WWN A;  1PX9 A;  1P0A A;  1WT7 A;  1VNA A;  2M8B B;  1JKZ A;  1SN4 A;  4HHF A;  1SN1 A;  2LT8 A;  1DJT A;  2YEO A;  4UJ0 A;  2NY8 X;  2KYQ A;  1OZZ A;  3PSM A;  5KK4 A;  2E0H A;  3E7U X;  1MYN A;  1JZA A;  2B68 A;  1C56 A;  2E3F A;  1WMT A;  1CN2 A;  2E3G A;  1FH3 A;  2KGQ A;  1VNB A; 
#chains in the Genus database with same CATH topology
 1PE4 A;  4AEI A;  1B7D A;  3CQX A;  4AAZ A;  5AQQ A;  4AB0 A;  2GL1 A;  2YC1 C;  1OMY A;  1NGD A;  1ZU3 A;  2E8A A;  3R2V A;  2N69 A;  2MBK A;  1NH5 A;  1BCG A;  1BA1 A;  5FPD A;  1NRA A;  4H5R A;  2KBK A;  3I33 A;  1I6F A;  4HWI A;  3IUC A;  1KAX A;  1NPI A;  2BRZ A;  1NGA A;  1NGJ A;  1LQI A;  2VY6 A;  1QQO A;  3C7N B;  3FZM A;  1S3X A;  1ZVG A;  1T1T A;  1NGF A;  1JXC A;  1ZFU A;  3GL1 A;  1NGH A;  1LQQ A;  1ATS A;  4H5T A;  5AQN A;  5AQL A;  1ZYW A;  1MR4 A;  3FZK A;  3KHW A;  3LDQ A;  5F1X A;  2KBJ A;  1AHO A;  1KAZ A;  3KP0 A;  2ATB A;  2D56 A;  2YBR C;  1BK8 A;  1BA0 A;  1PTX A;  1T7A A;  3LDO A;  4FSV A;  3FZF A;  2N2Q A;  4H5W A;  3QFU A;  5AQJ A;  3D2F A;  1K8B A;  1DQ7 A;  5F2R A;  1L4V A;  3KVG A;  1T0Z A;  2B3C A;  3A8Y A;  1ATR A;  4CQK A;  2E2F A;  2SN3 A;  2KHO A;  5FPE A;  2MN5 A;  1ICA A;  2A7T A;  4V1D C;  1NGI A;  5AQT A;  3AY9 A;  4UAE F;  1QQM A;  2LJM A;  3LDN A;  2QWP A;  4GNI A;  5F0X A;  1BRZ A;  1XRS B;  1DKG D;  5AQG A;  5BPL A;  3QML A;  3KOZ A;  3KOY A;  3QI7 A;  4KBO A;  5AQH A;  1I6G A;  1KV0 A;  2NY9 X;  5AQV A;  2KPY A;  1TI5 A;  2LJ7 A;  1HX1 A;  2E88 A;  1SEG A;  5AQS A;  5EY4 A;  5AQR A;  3D2F B;  1KAY A;  1HPM A;  1T7E A;  2I61 A;  2LR3 A;  4KYP A;  1ZVE A;  1I2U A;  3HSC A;  3E7R L;  3JXU A;  1NRB A;  5AQZ A;  1HJO A;  5AQP A;  5BN9 A;  1SNB A;  1C55 A;  1NE5 A;  1ZUT A;  1UGL A;  2BUP A;  1GPS A;  1CHZ A;  4FL9 A;  5AQM A;  1AYJ A;  5FPN A;  3FZH A;  2K35 A;  5AQX A;  1BUP A;  1JZB A;  1P00 A;  5BPN A;  2QXL A;  5CY0 A;  2YIP A;  1T7B A;  5FPM A;  1B3C A;  2KJA A;  4HE7 A;  1N4N A;  2YIL A;  2KBH A;  2LI7 A;  1NGC A;  3GDQ A;  2G2K A;  1I2V A;  4H5V A;  2LY5 A;  1NGE A;  5AQY A;  2N2R A;  1ZYV A;  3L56 A;  5AQK A;  2KSK A;  2LY6 A;  1GPT A;  5AQO A;  3L6Q A;  3ATV A;  2LKB A;  2MZ0 A;  2ASC A;  1LQH A;  2N66 A;  3FE1 A;  1BMR A;  3KOX A;  1YUW A;  3BK3 C;  2JDQ D;  3D2E A;  1WWN A;  3KP1 A;  3QFP A;  1PX9 A;  2LN8 A;  1P0A A;  1WT7 A;  5AQF A;  1VNA A;  5BPM A;  2M8B B;  4H5N A;  2V7Z A;  3FZL A;  2QWN A;  3CW4 A;  2QWQ A;  1JKZ A;  1SN4 A;  3ATU A;  4HHF A;  5AQW A;  1SN1 A;  2LT8 A;  1DJT A;  2YEO A;  3LDL A;  3LDP A;  3M3Z A;  4UJ0 A;  3GKU A;  5AQI A;  2NY8 X;  1NGG A;  4UAF E;  5AQU A;  3SF4 D;  5BN8 A;  2QWR A;  2KYQ A;  1OZZ A;  1NGB A;  5EXW A;  3PSM A;  5KK4 A;  2E0H A;  3E7U X;  2QW9 A;  1MYN A;  1JZA A;  2B68 A;  3D2E B;  1C56 A;  3KC6 A;  2GMO A;  2YIO A;  2E3F A;  3KOW A;  3L4I A;  2QWO A;  1QQN A;  4UAD E;  4IO8 A;  3C7N A;  2QWL A;  5EX5 A;  1WMT A;  2QWM A;  1CN2 A;  5EVZ A;  2E3G A;  1FH3 A;  2KGQ A;  1VNB A;  1POI A;  5AR0 A; 
#chains in the Genus database with same CATH homology
 1PE4 A;  4AEI A;  1B7D A;  4AAZ A;  4AB0 A;  2GL1 A;  2YC1 C;  1OMY A;  1ZU3 A;  2N69 A;  1NH5 A;  1BCG A;  1NRA A;  2KBK A;  1I6F A;  1NPI A;  2BRZ A;  1LQI A;  1ZVG A;  1T1T A;  1JXC A;  1ZFU A;  1LQQ A;  1ZYW A;  1MR4 A;  2KBJ A;  1AHO A;  2ATB A;  2YBR C;  1BK8 A;  1PTX A;  1T7A A;  2N2Q A;  1DQ7 A;  1L4V A;  1T0Z A;  2B3C A;  4CQK A;  2SN3 A;  1ICA A;  2A7T A;  4V1D C;  2LJM A;  1BRZ A;  1I6G A;  1KV0 A;  2NY9 X;  2KPY A;  1TI5 A;  2LJ7 A;  1SEG A;  4KYP A;  1T7E A;  2LR3 A;  2I61 A;  1ZVE A;  1I2U A;  3E7R L;  1NRB A;  1SNB A;  1C55 A;  1NE5 A;  1ZUT A;  1GPS A;  1CHZ A;  1AYJ A;  1JZB A;  1P00 A;  5CY0 A;  1T7B A;  1B3C A;  2KJA A;  4HE7 A;  1N4N A;  2KBH A;  2LI7 A;  1I2V A;  2LY5 A;  2N2R A;  1ZYV A;  2KSK A;  2LY6 A;  1GPT A;  2LKB A;  2MZ0 A;  2ASC A;  1LQH A;  2N66 A;  1BMR A;  1WWN A;  1PX9 A;  1P0A A;  1WT7 A;  1VNA A;  2M8B B;  1JKZ A;  1SN4 A;  4HHF A;  1SN1 A;  2LT8 A;  1DJT A;  2YEO A;  4UJ0 A;  2NY8 X;  2KYQ A;  1OZZ A;  3PSM A;  5KK4 A;  2E0H A;  3E7U X;  1MYN A;  1JZA A;  2B68 A;  1C56 A;  2E3F A;  1WMT A;  1CN2 A;  2E3G A;  1FH3 A;  2KGQ A;  1VNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...