1B7DA

Neurotoxin (ts1) from brazilian scorpion tityus serrulatus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PROTEIN (NEUROTOXIN TS1)
publication title Crystal structure of neurotoxin Ts1 from Tityus serrulatus provides insights into the specificity and toxicity of scorpion toxins.
pubmed doi rcsb
total genus 12
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1999-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1b7dA00
2NY9X 2N66A 4AEIA 1PX9A 1MR4A 4CQKA 1ZYWA 1SNBA 1LQHA 1SEGA 1AYJA 1LQQA 1CN2A 1GPSA 1P00A 1ZU3A 1T7BA 1OMYA 4HE7A 5KK4A 2LT8A 1DQ7A 2N69A 1SN1A 2KJAA 1L4VA 1NPIA 1VNAA 2B3CA 2KSKA 1T7AA 1NRBA 2N2QA 1BMRA 1AHOA 1NRAA 1OZZA 1JZBA 3PSMA 2YEOA 2E0HA 2YBRC 4V1DC 1GPTA 1ZYVA 2NY8X 1T7EA 1C55A 1JKZA 1I2UA 2ASCA 2GL1A 2N2RA 1WMTA 1BK8A 1I2VA 1WT7A 1C56A 1MYNA 2LY6A 2B68A 1PE4A 1TI5A 1CHZA 1KV0A 1JZAA 1JXCA 2ATBA 1PTXA 2KBHA 2YC1C 1T1TA 1FH3A 5CY0A 3E7UX 1I6FA 1B3CA 1NH5A 1LQIA 2LI7A 2LKBA 2E3GA 1I6GA 2SN3A 1ICAA 2LJ7A 1BCGA 2I61A 1VNBA 2KYQA 1WWNA 1P0AA 1B7DA 2KBJA 1DJTA 1BRZA 1SN4A 2MZ0A 1ZUTA 2KPYA 3E7RL 1NE5A 2KBKA 1N4NA 4AAZA 2E3FA 1ZFUA 2LJMA 2M8BB 4UJ0A 2KGQA 2LY5A 4HHFA 2BRZA 1T0ZA 1ZVEA 4KYPA 2A7TA 4AB0A 1ZVGA 2LR3A
chains in the Genus database with same CATH superfamily
2QWRA 2NY9X 2N66A 3LDOA 1PX9A 2BUPA 3HSCA 1MR4A 2GMOA 1ZYWA 4AEIA 4CQKA 3FZHA 1SNBA 5AQMA 1LQHA 1SEGA 1AYJA 1LQQA 1KAZA 5AQXA 1CN2A 1GPSA 2KHOA 4IO8A 1P00A 1ZU3A 3KP1A 3QMLA 1T7BA 2QWLA 3FZLA 3CQXA 5AQVA 1OMYA 2YIPA 5AQRA 4HE7A 4HWIA 3IUCA 5AQNA 2LT8A 5KK4A 3QFPA 2LN8A 3L56A 1KAXA 4H5WA 1HJOA 1DQ7A 1DKGD 5FPNA 1QQNA 2N69A 3LDQA 5F2RA 5AR0A 3D2FA 1SN1A 3C7NB 2KJAA 5BPMA 1L4VA 1QQOA 1YUWA 1NPIA 5AQWA 1BA1A 1VNAA 2YIOA 3L4IA 3LDLA 1KAYA 2B3CA 5F1XA 2QWPA 5AQTA 2KSKA 1T7AA 5AQUA 1NRBA 2VY6A 2N2QA 3KOYA 1BMRA 1UGLA 1AHOA 1NRAA 2MN5A 3SF4D 1XRSB 3GKUA 1OZZA 4UAEF 2MBKA 3ATVA 1JZBA 2QW9A 2YEOA 2D56A 3PSMA 2E0HA 3KOXA 5AQLA 2YBRC 3R2VA 4V1DC 5AQKA 1GPTA 5AQGA 1BUPA 1NGBA 3LDNA 3D2EA 1ZYVA 5AQFA 1QQMA 2NY8X 1T7EA 3FE1A 4FSVA 1C55A 3M3ZA 1JKZA 1BA0A 1NGGA 5BPLA 1I2UA 1NGIA 2ASCA 5AQYA 2GL1A 5FPEA 2JDQD 3GL1A 2N2RA 4H5NA 5EY4A 2E2FA 1WMTA 5EX5A 3L6QA 1BK8A 1I2VA 1WT7A 1C56A 1MYNA 2E8AA 3QFUA 2LY6A 2B68A 1PE4A 1TI5A 2K35A 1S3XA 1CHZA 1ATSA 1KV0A 3D2FB 3KVGA 1JZAA 1JXCA 2ATBA 4H5VA 3KOWA 4KBOA 3BK3C 1PTXA 1HX1A 2KBHA 2YC1C 5FPDA 1T1TA 2G2KA 3KC6A 3LDPA 2QXLA 5BPNA 1FH3A 5CY0A 5AQHA 3E7UX 1I6FA 5EXWA 1B3CA 1NH5A 3C7NA 3KP0A 3FZFA 1NGFA 1NGDA 1NGCA 1LQIA 1NGJA 2LI7A 3AY9A 2LKBA 3KHWA 1POIA 2QWNA 2E3GA 1I6GA 2SN3A 1NGAA 1ICAA 2LJ7A 3D2EB 3CW4A 3FZMA 4H5TA 1NGHA 5BN9A 1BCGA 2I61A 4UAFE 5AQZA 1VNBA 2KYQA 1HPMA 5AQIA 1WWNA 1NGEA 1P0AA 1B7DA 2KBJA 1DJTA 5BN8A 3JXUA 1SN4A 2MZ0A 1ZUTA 3KOZA 4GNIA 4UADE 2KPYA 1BRZA 3E7RL 1NE5A 3A8YA 4FL9A 2QWOA 3GDQA 5EVZA 2YILA 4H5RA 2KBKA 2QWQA 2QWMA 5FPMA 1N4NA 4AAZA 2E3FA 1ZFUA 2LJMA 2M8BB 3FZKA 2V7ZA 3I33A 1K8BA 4UJ0A 2KGQA 5F0XA 2LY5A 4HHFA 2BRZA 5AQPA 3QI7A 1T0ZA 1ZVEA 4KYPA 5AQOA 5AQJA 2A7TA 2E88A 1ATRA 5AQSA 4AB0A 1ZVGA 5AQQA 3ATUA 2LR3A
chains in the Genus database with same CATH topology
2NY9X 2N66A 4AEIA 1PX9A 1MR4A 4CQKA 1ZYWA 1SNBA 1LQHA 1SEGA 1AYJA 1LQQA 1CN2A 1GPSA 1P00A 1ZU3A 1T7BA 1OMYA 4HE7A 5KK4A 2LT8A 1DQ7A 2N69A 1SN1A 2KJAA 1L4VA 1NPIA 1VNAA 2B3CA 2KSKA 1T7AA 1NRBA 2N2QA 1BMRA 1AHOA 1NRAA 1OZZA 1JZBA 3PSMA 2YEOA 2E0HA 2YBRC 4V1DC 1GPTA 1ZYVA 2NY8X 1T7EA 1C55A 1JKZA 1I2UA 2ASCA 2GL1A 2N2RA 1WMTA 1BK8A 1I2VA 1WT7A 1C56A 1MYNA 2LY6A 2B68A 1PE4A 1TI5A 1CHZA 1KV0A 1JZAA 1JXCA 2ATBA 1PTXA 2KBHA 2YC1C 1T1TA 1FH3A 5CY0A 3E7UX 1I6FA 1B3CA 1NH5A 1LQIA 2LI7A 2LKBA 2E3GA 1I6GA 2SN3A 1ICAA 2LJ7A 1BCGA 2I61A 1VNBA 2KYQA 1WWNA 1P0AA 1B7DA 2KBJA 1DJTA 1BRZA 1SN4A 2MZ0A 1ZUTA 2KPYA 3E7RL 1NE5A 2KBKA 1N4NA 4AAZA 2E3FA 1ZFUA 2LJMA 2M8BB 4UJ0A 2KGQA 2LY5A 4HHFA 2BRZA 1T0ZA 1ZVEA 4KYPA 2A7TA 4AB0A 1ZVGA 2LR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NY9 X;  2N66 A;  4AEI A;  1PX9 A;  1MR4 A;  4CQK A;  1ZYW A;  1SNB A;  1LQH A;  1SEG A;  1AYJ A;  1LQQ A;  1CN2 A;  1GPS A;  1P00 A;  1ZU3 A;  1T7B A;  1OMY A;  4HE7 A;  5KK4 A;  2LT8 A;  1DQ7 A;  2N69 A;  1SN1 A;  2KJA A;  1L4V A;  1NPI A;  1VNA A;  2B3C A;  2KSK A;  1T7A A;  1NRB A;  2N2Q A;  1BMR A;  1AHO A;  1NRA A;  1OZZ A;  1JZB A;  3PSM A;  2YEO A;  2E0H A;  2YBR C;  4V1D C;  1GPT A;  1ZYV A;  2NY8 X;  1T7E A;  1C55 A;  1JKZ A;  1I2U A;  2ASC A;  2GL1 A;  2N2R A;  1WMT A;  1BK8 A;  1I2V A;  1WT7 A;  1C56 A;  1MYN A;  2LY6 A;  2B68 A;  1PE4 A;  1TI5 A;  1CHZ A;  1KV0 A;  1JZA A;  1JXC A;  2ATB A;  1PTX A;  2KBH A;  2YC1 C;  1T1T A;  1FH3 A;  5CY0 A;  3E7U X;  1I6F A;  1B3C A;  1NH5 A;  1LQI A;  2LI7 A;  2LKB A;  2E3G A;  1I6G A;  2SN3 A;  1ICA A;  2LJ7 A;  1BCG A;  2I61 A;  1VNB A;  2KYQ A;  1WWN A;  1P0A A;  1B7D A;  2KBJ A;  1DJT A;  1BRZ A;  1SN4 A;  2MZ0 A;  1ZUT A;  2KPY A;  3E7R L;  1NE5 A;  2KBK A;  1N4N A;  4AAZ A;  2E3F A;  1ZFU A;  2LJM A;  2M8B B;  4UJ0 A;  2KGQ A;  2LY5 A;  4HHF A;  2BRZ A;  1T0Z A;  1ZVE A;  4KYP A;  2A7T A;  4AB0 A;  1ZVG A;  2LR3 A; 
#chains in the Genus database with same CATH topology
 2QWR A;  2NY9 X;  2N66 A;  3LDO A;  1PX9 A;  2BUP A;  3HSC A;  1MR4 A;  2GMO A;  1ZYW A;  4AEI A;  4CQK A;  3FZH A;  1SNB A;  5AQM A;  1LQH A;  1SEG A;  1AYJ A;  1LQQ A;  1KAZ A;  5AQX A;  1CN2 A;  1GPS A;  2KHO A;  4IO8 A;  1P00 A;  1ZU3 A;  3KP1 A;  3QML A;  1T7B A;  2QWL A;  3FZL A;  3CQX A;  5AQV A;  1OMY A;  2YIP A;  5AQR A;  4HE7 A;  4HWI A;  3IUC A;  5AQN A;  2LT8 A;  5KK4 A;  3QFP A;  2LN8 A;  3L56 A;  1KAX A;  4H5W A;  1HJO A;  1DQ7 A;  1DKG D;  5FPN A;  1QQN A;  2N69 A;  3LDQ A;  5F2R A;  5AR0 A;  3D2F A;  1SN1 A;  3C7N B;  2KJA A;  5BPM A;  1L4V A;  1QQO A;  1YUW A;  1NPI A;  5AQW A;  1BA1 A;  1VNA A;  2YIO A;  3L4I A;  3LDL A;  1KAY A;  2B3C A;  5F1X A;  2QWP A;  5AQT A;  2KSK A;  1T7A A;  5AQU A;  1NRB A;  2VY6 A;  2N2Q A;  3KOY A;  1BMR A;  1UGL A;  1AHO A;  1NRA A;  2MN5 A;  3SF4 D;  1XRS B;  3GKU A;  1OZZ A;  4UAE F;  2MBK A;  3ATV A;  1JZB A;  2QW9 A;  2YEO A;  2D56 A;  3PSM A;  2E0H A;  3KOX A;  5AQL A;  2YBR C;  3R2V A;  4V1D C;  5AQK A;  1GPT A;  5AQG A;  1BUP A;  1NGB A;  3LDN A;  3D2E A;  1ZYV A;  5AQF A;  1QQM A;  2NY8 X;  1T7E A;  3FE1 A;  4FSV A;  1C55 A;  3M3Z A;  1JKZ A;  1BA0 A;  1NGG A;  5BPL A;  1I2U A;  1NGI A;  2ASC A;  5AQY A;  2GL1 A;  5FPE A;  2JDQ D;  3GL1 A;  2N2R A;  4H5N A;  5EY4 A;  2E2F A;  1WMT A;  5EX5 A;  3L6Q A;  1BK8 A;  1I2V A;  1WT7 A;  1C56 A;  1MYN A;  2E8A A;  3QFU A;  2LY6 A;  2B68 A;  1PE4 A;  1TI5 A;  2K35 A;  1S3X A;  1CHZ A;  1ATS A;  1KV0 A;  3D2F B;  3KVG A;  1JZA A;  1JXC A;  2ATB A;  4H5V A;  3KOW A;  4KBO A;  3BK3 C;  1PTX A;  1HX1 A;  2KBH A;  2YC1 C;  5FPD A;  1T1T A;  2G2K A;  3KC6 A;  3LDP A;  2QXL A;  5BPN A;  1FH3 A;  5CY0 A;  5AQH A;  3E7U X;  1I6F A;  5EXW A;  1B3C A;  1NH5 A;  3C7N A;  3KP0 A;  3FZF A;  1NGF A;  1NGD A;  1NGC A;  1LQI A;  1NGJ A;  2LI7 A;  3AY9 A;  2LKB A;  3KHW A;  1POI A;  2QWN A;  2E3G A;  1I6G A;  2SN3 A;  1NGA A;  1ICA A;  2LJ7 A;  3D2E B;  3CW4 A;  3FZM A;  4H5T A;  1NGH A;  5BN9 A;  1BCG A;  2I61 A;  4UAF E;  5AQZ A;  1VNB A;  2KYQ A;  1HPM A;  5AQI A;  1WWN A;  1NGE A;  1P0A A;  1B7D A;  2KBJ A;  1DJT A;  5BN8 A;  3JXU A;  1SN4 A;  2MZ0 A;  1ZUT A;  3KOZ A;  4GNI A;  4UAD E;  2KPY A;  1BRZ A;  3E7R L;  1NE5 A;  3A8Y A;  4FL9 A;  2QWO A;  3GDQ A;  5EVZ A;  2YIL A;  4H5R A;  2KBK A;  2QWQ A;  2QWM A;  5FPM A;  1N4N A;  4AAZ A;  2E3F A;  1ZFU A;  2LJM A;  2M8B B;  3FZK A;  2V7Z A;  3I33 A;  1K8B A;  4UJ0 A;  2KGQ A;  5F0X A;  2LY5 A;  4HHF A;  2BRZ A;  5AQP A;  3QI7 A;  1T0Z A;  1ZVE A;  4KYP A;  5AQO A;  5AQJ A;  2A7T A;  2E88 A;  1ATR A;  5AQS A;  4AB0 A;  1ZVG A;  5AQQ A;  3ATU A;  2LR3 A; 
#chains in the Genus database with same CATH homology
 2NY9 X;  2N66 A;  4AEI A;  1PX9 A;  1MR4 A;  4CQK A;  1ZYW A;  1SNB A;  1LQH A;  1SEG A;  1AYJ A;  1LQQ A;  1CN2 A;  1GPS A;  1P00 A;  1ZU3 A;  1T7B A;  1OMY A;  4HE7 A;  5KK4 A;  2LT8 A;  1DQ7 A;  2N69 A;  1SN1 A;  2KJA A;  1L4V A;  1NPI A;  1VNA A;  2B3C A;  2KSK A;  1T7A A;  1NRB A;  2N2Q A;  1BMR A;  1AHO A;  1NRA A;  1OZZ A;  1JZB A;  3PSM A;  2YEO A;  2E0H A;  2YBR C;  4V1D C;  1GPT A;  1ZYV A;  2NY8 X;  1T7E A;  1C55 A;  1JKZ A;  1I2U A;  2ASC A;  2GL1 A;  2N2R A;  1WMT A;  1BK8 A;  1I2V A;  1WT7 A;  1C56 A;  1MYN A;  2LY6 A;  2B68 A;  1PE4 A;  1TI5 A;  1CHZ A;  1KV0 A;  1JZA A;  1JXC A;  2ATB A;  1PTX A;  2KBH A;  2YC1 C;  1T1T A;  1FH3 A;  5CY0 A;  3E7U X;  1I6F A;  1B3C A;  1NH5 A;  1LQI A;  2LI7 A;  2LKB A;  2E3G A;  1I6G A;  2SN3 A;  1ICA A;  2LJ7 A;  1BCG A;  2I61 A;  1VNB A;  2KYQ A;  1WWN A;  1P0A A;  1B7D A;  2KBJ A;  1DJT A;  1BRZ A;  1SN4 A;  2MZ0 A;  1ZUT A;  2KPY A;  3E7R L;  1NE5 A;  2KBK A;  1N4N A;  4AAZ A;  2E3F A;  1ZFU A;  2LJM A;  2M8B B;  4UJ0 A;  2KGQ A;  2LY5 A;  4HHF A;  2BRZ A;  1T0Z A;  1ZVE A;  4KYP A;  2A7T A;  4AB0 A;  1ZVG A;  2LR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...