1B7DA

Neurotoxin (ts1) from brazilian scorpion tityus serrulatus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (NEUROTOXIN TS1)
publication title Crystal structure of neurotoxin Ts1 from Tityus serrulatus provides insights into the specificity and toxicity of scorpion toxins.
pubmed doi rcsb
molecule tags Toxin
total genus 12
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1999-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1b7dA00
2MZ0A 2YEOA 4UJ0A 1ICAA 1N4NA 3PSMA 1NE5A 4CQKA 1BK8A 1ZYVA 2KJAA 2LKBA 4HHFA 2N66A 1T7BA 2KPYA 2LY5A 1T0ZA 2M8BB 2BRZA 4AAZA 2ATBA 4KYPA 1LQHA 1WMTA 1JZAA 1I6GA 2LI7A 1C56A 1DJTA 1PTXA 2YC1C 1I2VA 1PX9A 1PE4A 1JKZA 1OZZA 2E0HA 2N2QA 2KSKA 1L4VA 1NRBA 2KBJA 1TI5A 1SN1A 2ASCA 1AYJA 1NPIA 1AHOA 2KYQA 1NRAA 1JZBA 1MR4A 1WT7A 3E7RL 1NH5A 2B68A 1VNBA 1LQQA 1B7DA 1OMYA 2NY9X 2LR3A 2A7TA 1BMRA 2SN3A 2NY8X 1T7EA 1ZVGA 3E7UX 4AB0A 1P0AA 1ZYWA 2LJMA 1CN2A 2N69A 2N2RA 4HE7A 4AEIA 1I2UA 1ZFUA 4V1DC 1LQIA 1GPTA 2LY6A 1T1TA 1C55A 2GL1A 1SNBA 2I61A 2KBKA 5KK4A 2KBHA 2YBRC 2LJ7A 2E3FA 1JXCA 1SEGA 2B3CA 1DQ7A 1CHZA 1GPSA 2KGQA 1ZVEA 1B3CA 1P00A 1MYNA 2E3GA 1KV0A 1ZUTA 2LT8A 5CY0A 1VNAA 1I6FA 1SN4A 1FH3A 1WWNA 1BCGA 1BRZA 1T7AA 1ZU3A
chains in the Genus database with same CATH superfamily
2QWNA 2MZ0A 2YEOA 5F1XA 4UJ0A 1ICAA 1N4NA 1NGEA 3D2FB 5FPNA 2D56A 3PSMA 1NE5A 4CQKA 2E2FA 1BK8A 1ZYVA 3JXUA 4IO8A 2KJAA 2LKBA 4HHFA 2N66A 1T7BA 2KPYA 2YILA 2LY5A 1T0ZA 5FPEA 2M8BB 3ATUA 5BPMA 3KOWA 2BRZA 5AR0A 2JDQD 4AAZA 2ATBA 5AQOA 5BPNA 5FPMA 1K8BA 4KYPA 1LQHA 1WMTA 1JZAA 5BN9A 1I6GA 3QI7A 5AQYA 2LI7A 3KP0A 1NGAA 1C56A 1S3XA 1DJTA 1HX1A 1T7AA 3FZKA 5BPLA 1NGHA 2V7ZA 2YIPA 3BK3C 5AQNA 1PTXA 3KOZA 4H5WA 2YC1C 3GDQA 5AQPA 1I2VA 1PX9A 5AQSA 5AQVA 1PE4A 4UAFE 1JKZA 4KBOA 3KHWA 1YUWA 1OZZA 3D2FA 2QWQA 3LDQA 2E0HA 1ATSA 1KAXA 2KSKA 2N2QA 3L4IA 3QMLA 3FZFA 5EX5A 1L4VA 1NRBA 2KBJA 1TI5A 5AQFA 1SN1A 2ASCA 1AYJA 1NPIA 1NGFA 5AQIA 3D2EB 2MBKA 1AHOA 2KYQA 1NRAA 1ZU3A 4H5TA 1JZBA 1MR4A 1WT7A 2QWOA 3E7RL 1NH5A 3I33A 3QFUA 2B68A 1VNBA 1LQQA 1NGDA 3KP1A 1B7DA 5AQMA 5EXWA 3KC6A 1UGLA 1FH3A 3ATVA 1OMYA 2NY9X 3CW4A 3QFPA 2LR3A 2E8AA 2QW9A 2VY6A 3C7NB 4GNIA 3HSCA 3KVGA 3R2VA 5AQRA 5AQUA 5AQLA 2QWLA 5EY4A 1NGGA 3SF4D 2A7TA 1NGCA 1BMRA 2SN3A 1BA1A 3FE1A 4H5RA 2QWMA 2G2KA 2NY8X 1T7EA 1ZVGA 5AQJA 3GL1A 3E7UX 1BRZA 3AY9A 4HWIA 1QQNA 2QWPA 4AB0A 1P0AA 1ZYWA 2QXLA 2LJMA 5F0XA 4UADE 1CN2A 2KHOA 1DKGD 5AQQA 2GMOA 2N69A 3M3ZA 2N2RA 4HE7A 1ATRA 4AEIA 1I2UA 2BUPA 3FZMA 2E88A 5F2RA 1ZFUA 2QWRA 1LQIA 4V1DC 1HJOA 5AQZA 5CY0A 2LY6A 1GPTA 1KAZA 1T1TA 1BA0A 3KOXA 1C55A 2GL1A 1SNBA 5AQHA 2I61A 2KBKA 3LDNA 4FSVA 3LDPA 3D2EA 5KK4A 1NGJA 2KBHA 2LJ7A 2YBRC 2E3FA 3L56A 1JXCA 2MN5A 1SEGA 3GKUA 3LDLA 2B3CA 1DQ7A 4UAEF 3CQXA 2K35A 3FZHA 1CHZA 2LN8A 4FL9A 3C7NA 3L6QA 2KGQA 5FPDA 1ZVEA 1GPSA 1KAYA 1XRSB 5AQXA 1B3CA 5AQKA 1P00A 1MYNA 2E3GA 2YIOA 5AQWA 1KV0A 1ZUTA 1QQMA 1QQOA 2LT8A 1HPMA 1POIA 3A8YA 3IUCA 4H5NA 5AQTA 1VNAA 3FZLA 1I6FA 3KOYA 5AQGA 3LDOA 1SN4A 1NGIA 1WWNA 1BCGA 5EVZA 4H5VA 1BUPA 1NGBA 5BN8A
chains in the Genus database with same CATH topology
2MZ0A 2YEOA 4UJ0A 1ICAA 1N4NA 3PSMA 1NE5A 4CQKA 1BK8A 1ZYVA 2KJAA 2LKBA 4HHFA 2N66A 1T7BA 2KPYA 2LY5A 1T0ZA 2M8BB 2BRZA 4AAZA 2ATBA 4KYPA 1LQHA 1WMTA 1JZAA 1I6GA 2LI7A 1C56A 1DJTA 1PTXA 2YC1C 1I2VA 1PX9A 1PE4A 1JKZA 1OZZA 2E0HA 2N2QA 2KSKA 1L4VA 1NRBA 2KBJA 1TI5A 1SN1A 2ASCA 1AYJA 1NPIA 1AHOA 2KYQA 1NRAA 1JZBA 1MR4A 1WT7A 3E7RL 1NH5A 2B68A 1VNBA 1LQQA 1B7DA 1OMYA 2NY9X 2LR3A 2A7TA 1BMRA 2SN3A 2NY8X 1T7EA 1ZVGA 3E7UX 4AB0A 1P0AA 1ZYWA 2LJMA 1CN2A 2N69A 2N2RA 4HE7A 4AEIA 1I2UA 1ZFUA 4V1DC 1LQIA 1GPTA 2LY6A 1T1TA 1C55A 2GL1A 1SNBA 2I61A 2KBKA 5KK4A 2KBHA 2YBRC 2LJ7A 2E3FA 1JXCA 1SEGA 2B3CA 1DQ7A 1CHZA 1GPSA 2KGQA 1ZVEA 1B3CA 1P00A 1MYNA 2E3GA 1KV0A 1ZUTA 2LT8A 5CY0A 1VNAA 1I6FA 1SN4A 1FH3A 1WWNA 1BCGA 1BRZA 1T7AA 1ZU3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MZ0 A;  2YEO A;  4UJ0 A;  1ICA A;  1N4N A;  3PSM A;  1NE5 A;  4CQK A;  1BK8 A;  1ZYV A;  2KJA A;  2LKB A;  4HHF A;  2N66 A;  1T7B A;  2KPY A;  2LY5 A;  1T0Z A;  2M8B B;  2BRZ A;  4AAZ A;  2ATB A;  4KYP A;  1LQH A;  1WMT A;  1JZA A;  1I6G A;  2LI7 A;  1C56 A;  1DJT A;  1PTX A;  2YC1 C;  1I2V A;  1PX9 A;  1PE4 A;  1JKZ A;  1OZZ A;  2E0H A;  2N2Q A;  2KSK A;  1L4V A;  1NRB A;  2KBJ A;  1TI5 A;  1SN1 A;  2ASC A;  1AYJ A;  1NPI A;  1AHO A;  2KYQ A;  1NRA A;  1JZB A;  1MR4 A;  1WT7 A;  3E7R L;  1NH5 A;  2B68 A;  1VNB A;  1LQQ A;  1B7D A;  1OMY A;  2NY9 X;  2LR3 A;  2A7T A;  1BMR A;  2SN3 A;  2NY8 X;  1T7E A;  1ZVG A;  3E7U X;  4AB0 A;  1P0A A;  1ZYW A;  2LJM A;  1CN2 A;  2N69 A;  2N2R A;  4HE7 A;  4AEI A;  1I2U A;  1ZFU A;  4V1D C;  1LQI A;  1GPT A;  2LY6 A;  1T1T A;  1C55 A;  2GL1 A;  1SNB A;  2I61 A;  2KBK A;  5KK4 A;  2KBH A;  2YBR C;  2LJ7 A;  2E3F A;  1JXC A;  1SEG A;  2B3C A;  1DQ7 A;  1CHZ A;  1GPS A;  2KGQ A;  1ZVE A;  1B3C A;  1P00 A;  1MYN A;  2E3G A;  1KV0 A;  1ZUT A;  2LT8 A;  5CY0 A;  1VNA A;  1I6F A;  1SN4 A;  1FH3 A;  1WWN A;  1BCG A;  1BRZ A;  1T7A A;  1ZU3 A; 
#chains in the Genus database with same CATH topology
 2QWN A;  2MZ0 A;  2YEO A;  5F1X A;  4UJ0 A;  1ICA A;  1N4N A;  1NGE A;  3D2F B;  5FPN A;  2D56 A;  3PSM A;  1NE5 A;  4CQK A;  2E2F A;  1BK8 A;  1ZYV A;  3JXU A;  4IO8 A;  2KJA A;  2LKB A;  4HHF A;  2N66 A;  1T7B A;  2KPY A;  2YIL A;  2LY5 A;  1T0Z A;  5FPE A;  2M8B B;  3ATU A;  5BPM A;  3KOW A;  2BRZ A;  5AR0 A;  2JDQ D;  4AAZ A;  2ATB A;  5AQO A;  5BPN A;  5FPM A;  1K8B A;  4KYP A;  1LQH A;  1WMT A;  1JZA A;  5BN9 A;  1I6G A;  3QI7 A;  5AQY A;  2LI7 A;  3KP0 A;  1NGA A;  1C56 A;  1S3X A;  1DJT A;  1HX1 A;  1T7A A;  3FZK A;  5BPL A;  1NGH A;  2V7Z A;  2YIP A;  3BK3 C;  5AQN A;  1PTX A;  3KOZ A;  4H5W A;  2YC1 C;  3GDQ A;  5AQP A;  1I2V A;  1PX9 A;  5AQS A;  5AQV A;  1PE4 A;  4UAF E;  1JKZ A;  4KBO A;  3KHW A;  1YUW A;  1OZZ A;  3D2F A;  2QWQ A;  3LDQ A;  2E0H A;  1ATS A;  1KAX A;  2KSK A;  2N2Q A;  3L4I A;  3QML A;  3FZF A;  5EX5 A;  1L4V A;  1NRB A;  2KBJ A;  1TI5 A;  5AQF A;  1SN1 A;  2ASC A;  1AYJ A;  1NPI A;  1NGF A;  5AQI A;  3D2E B;  2MBK A;  1AHO A;  2KYQ A;  1NRA A;  1ZU3 A;  4H5T A;  1JZB A;  1MR4 A;  1WT7 A;  2QWO A;  3E7R L;  1NH5 A;  3I33 A;  3QFU A;  2B68 A;  1VNB A;  1LQQ A;  1NGD A;  3KP1 A;  1B7D A;  5AQM A;  5EXW A;  3KC6 A;  1UGL A;  1FH3 A;  3ATV A;  1OMY A;  2NY9 X;  3CW4 A;  3QFP A;  2LR3 A;  2E8A A;  2QW9 A;  2VY6 A;  3C7N B;  4GNI A;  3HSC A;  3KVG A;  3R2V A;  5AQR A;  5AQU A;  5AQL A;  2QWL A;  5EY4 A;  1NGG A;  3SF4 D;  2A7T A;  1NGC A;  1BMR A;  2SN3 A;  1BA1 A;  3FE1 A;  4H5R A;  2QWM A;  2G2K A;  2NY8 X;  1T7E A;  1ZVG A;  5AQJ A;  3GL1 A;  3E7U X;  1BRZ A;  3AY9 A;  4HWI A;  1QQN A;  2QWP A;  4AB0 A;  1P0A A;  1ZYW A;  2QXL A;  2LJM A;  5F0X A;  4UAD E;  1CN2 A;  2KHO A;  1DKG D;  5AQQ A;  2GMO A;  2N69 A;  3M3Z A;  2N2R A;  4HE7 A;  1ATR A;  4AEI A;  1I2U A;  2BUP A;  3FZM A;  2E88 A;  5F2R A;  1ZFU A;  2QWR A;  1LQI A;  4V1D C;  1HJO A;  5AQZ A;  5CY0 A;  2LY6 A;  1GPT A;  1KAZ A;  1T1T A;  1BA0 A;  3KOX A;  1C55 A;  2GL1 A;  1SNB A;  5AQH A;  2I61 A;  2KBK A;  3LDN A;  4FSV A;  3LDP A;  3D2E A;  5KK4 A;  1NGJ A;  2KBH A;  2LJ7 A;  2YBR C;  2E3F A;  3L56 A;  1JXC A;  2MN5 A;  1SEG A;  3GKU A;  3LDL A;  2B3C A;  1DQ7 A;  4UAE F;  3CQX A;  2K35 A;  3FZH A;  1CHZ A;  2LN8 A;  4FL9 A;  3C7N A;  3L6Q A;  2KGQ A;  5FPD A;  1ZVE A;  1GPS A;  1KAY A;  1XRS B;  5AQX A;  1B3C A;  5AQK A;  1P00 A;  1MYN A;  2E3G A;  2YIO A;  5AQW A;  1KV0 A;  1ZUT A;  1QQM A;  1QQO A;  2LT8 A;  1HPM A;  1POI A;  3A8Y A;  3IUC A;  4H5N A;  5AQT A;  1VNA A;  3FZL A;  1I6F A;  3KOY A;  5AQG A;  3LDO A;  1SN4 A;  1NGI A;  1WWN A;  1BCG A;  5EVZ A;  4H5V A;  1BUP A;  1NGB A;  5BN8 A; 
#chains in the Genus database with same CATH homology
 2MZ0 A;  2YEO A;  4UJ0 A;  1ICA A;  1N4N A;  3PSM A;  1NE5 A;  4CQK A;  1BK8 A;  1ZYV A;  2KJA A;  2LKB A;  4HHF A;  2N66 A;  1T7B A;  2KPY A;  2LY5 A;  1T0Z A;  2M8B B;  2BRZ A;  4AAZ A;  2ATB A;  4KYP A;  1LQH A;  1WMT A;  1JZA A;  1I6G A;  2LI7 A;  1C56 A;  1DJT A;  1PTX A;  2YC1 C;  1I2V A;  1PX9 A;  1PE4 A;  1JKZ A;  1OZZ A;  2E0H A;  2N2Q A;  2KSK A;  1L4V A;  1NRB A;  2KBJ A;  1TI5 A;  1SN1 A;  2ASC A;  1AYJ A;  1NPI A;  1AHO A;  2KYQ A;  1NRA A;  1JZB A;  1MR4 A;  1WT7 A;  3E7R L;  1NH5 A;  2B68 A;  1VNB A;  1LQQ A;  1B7D A;  1OMY A;  2NY9 X;  2LR3 A;  2A7T A;  1BMR A;  2SN3 A;  2NY8 X;  1T7E A;  1ZVG A;  3E7U X;  4AB0 A;  1P0A A;  1ZYW A;  2LJM A;  1CN2 A;  2N69 A;  2N2R A;  4HE7 A;  4AEI A;  1I2U A;  1ZFU A;  4V1D C;  1LQI A;  1GPT A;  2LY6 A;  1T1T A;  1C55 A;  2GL1 A;  1SNB A;  2I61 A;  2KBK A;  5KK4 A;  2KBH A;  2YBR C;  2LJ7 A;  2E3F A;  1JXC A;  1SEG A;  2B3C A;  1DQ7 A;  1CHZ A;  1GPS A;  2KGQ A;  1ZVE A;  1B3C A;  1P00 A;  1MYN A;  2E3G A;  1KV0 A;  1ZUT A;  2LT8 A;  5CY0 A;  1VNA A;  1I6F A;  1SN4 A;  1FH3 A;  1WWN A;  1BCG A;  1BRZ A;  1T7A A;  1ZU3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...