1T7AA

Crystal structure of mutant lys8asp of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
66
structure length
66
Chain Sequence
NSVRDAYIADPHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-like neurotoxin BmK-I
publication title Structural Mechanism Governing Cis and Trans Isomeric States and an Intramolecular Switch for Cis/Trans Isomerization of a Non-proline Peptide Bond Observed in Crystal Structures of Scorpion Toxins
pubmed doi rcsb
source organism Mesobuthus martensii
molecule tags Toxin
total genus 18
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1t7aA00
2KBKA 2BRZA 1MR4A 2ASCA 2B3CA 1MYNA 2KYQA 1ZFUA 2KBHA 2KGQA 4HHFA 2LJMA 1B7DA 1NPIA 1ZVEA 2A7TA 1ZYVA 1OMYA 1NE5A 1BRZA 1C56A 1TI5A 2N2RA 1NRBA 1BK8A 2MZ0A 1I6GA 5CY0A 1OZZA 1GPSA 1T0ZA 2LY6A 1JKZA 2NY8X 1FH3A 2LR3A 1LQHA 2ATBA 1NH5A 2LY5A 2YBRC 3E7UX 2LI7A 4V1DC 2SN3A 1PE4A 1ICAA 1KV0A 1PX9A 1BCGA 1LQIA 1N4NA 1WWNA 1ZYWA 1DJTA 1JZAA 4HE7A 1WMTA 1C55A 1DQ7A 1I2UA 1T7BA 1AHOA 1NRAA 2M8BB 1GPTA 2N66A 2KJAA 1BMRA 1CHZA 1P0AA 2LKBA 1LQQA 2LJ7A 1L4VA 4UJ0A 1PTXA 1P00A 2KPYA 2NY9X 1SNBA 2KBJA 1ZU3A 5KK4A 2YEOA 4KYPA 1I2VA 2E0HA 2N69A 2N2QA 1T7AA 4AEIA 1VNBA 2GL1A 4AAZA 2E3GA 1T7EA 1CN2A 4CQKA 2E3FA 1SN1A 4AB0A 2I61A 1I6FA 1WT7A 1JXCA 2KSKA 3E7RL 2LT8A 1SEGA 1ZVGA 1SN4A 1T1TA 1VNAA 1JZBA 1AYJA 1ZUTA 3PSMA 2B68A 1B3CA 2YC1C
chains in the Genus database with same CATH superfamily
5AQGA 2JDQD 2KBKA 1KAZA 2BRZA 3KHWA 1NGIA 1MR4A 2ASCA 2B3CA 1MYNA 5AQKA 2KYQA 2QWQA 3R2VA 1ZFUA 2KBHA 3KVGA 1HJOA 2KGQA 4H5RA 4HHFA 2LJMA 3L4IA 1B7DA 5F1XA 5AQZA 1NPIA 1ZVEA 1NGHA 2A7TA 3D2FB 1QQNA 1ZYVA 1OMYA 3GL1A 4GNIA 3KOXA 3FE1A 5FPDA 1NGGA 1NE5A 1BRZA 1C56A 1XRSB 1TI5A 4H5VA 4HWIA 2N2RA 5AQFA 1NRBA 3AY9A 5AQLA 1DKGD 3BK3C 3IUCA 3QFPA 4H5TA 4H5NA 1BK8A 2MZ0A 1I6GA 5CY0A 5BN8A 3C7NA 1OZZA 3LDOA 1GPSA 5AQRA 1T0ZA 2LY6A 3LDPA 1HPMA 1JKZA 2NY8X 1NGJA 5AQQA 4FL9A 5AQHA 1FH3A 2YILA 5AQXA 2LR3A 2YIPA 1LQHA 2ATBA 1NH5A 2LY5A 3KP1A 1BA1A 5EVZA 1NGDA 2YBRC 3E7UX 3HSCA 3L6QA 2LI7A 1NGBA 5AQVA 2E2FA 2E8AA 2QWMA 3KOYA 4V1DC 2SN3A 1PE4A 4H5WA 4KBOA 4UAFE 1ICAA 1KV0A 1PX9A 2QWRA 3FZFA 3C7NB 1BCGA 1BUPA 2YIOA 1LQIA 5AQMA 5BPLA 1N4NA 1WWNA 3ATUA 5BPMA 1ZYWA 1DJTA 1JZAA 4HE7A 1NGAA 1YUWA 3FZMA 1WMTA 1C55A 1DQ7A 3QFUA 1T7BA 1AHOA 1NRAA 2M8BB 5AQSA 5EXWA 1GPTA 1I2UA 2N66A 3KP0A 2BUPA 2KJAA 5EX5A 1ATRA 1CHZA 1P0AA 3D2EA 4UAEF 1BMRA 2MN5A 3JXUA 3KOWA 1KAXA 2LKBA 5AQJA 5AQWA 5BPNA 1LQQA 3CQXA 1NGEA 1ATSA 2G2KA 2LJ7A 5F0XA 1L4VA 4UJ0A 1PTXA 5AQIA 1P00A 5AQNA 2QWLA 2K35A 5FPNA 2KPYA 2NY9X 1SNBA 2KBJA 2QWOA 1ZU3A 3FZKA 2LN8A 2YEOA 1QQOA 3L56A 4KYPA 5AQTA 5BN9A 5KK4A 1I2VA 1NGFA 2E0HA 2N69A 2N2QA 4IO8A 3LDNA 1T7AA 4UADE 3QI7A 3A8YA 4AEIA 3I33A 1VNBA 2GL1A 3FZHA 4AAZA 3D2EB 5F2RA 2E3GA 1T7EA 2D56A 1S3XA 5EY4A 5FPEA 1CN2A 2KHOA 4CQKA 3KC6A 3GKUA 2E3FA 2GMOA 3LDLA 3SF4D 1SN1A 1K8BA 3QMLA 4AB0A 3GDQA 2QWPA 2V7ZA 3ATVA 2MBKA 2I61A 1UGLA 1I6FA 1WT7A 3M3ZA 2QXLA 3KOZA 1HX1A 2E88A 1JXCA 1KAYA 5AQUA 2KSKA 5AR0A 3D2FA 3CW4A 3E7RL 2LT8A 2QW9A 5AQPA 1SEGA 1ZVGA 1QQMA 1SN4A 1BA0A 1T1TA 1VNAA 5AQYA 2VY6A 1JZBA 1AYJA 4FSVA 2QWNA 1POIA 1ZUTA 3PSMA 1NGCA 3FZLA 3LDQA 2B68A 1B3CA 2YC1C 5FPMA 5AQOA
chains in the Genus database with same CATH topology
2KBKA 2BRZA 1MR4A 2ASCA 2B3CA 1MYNA 2KYQA 1ZFUA 2KBHA 2KGQA 4HHFA 2LJMA 1B7DA 1NPIA 1ZVEA 2A7TA 1ZYVA 1OMYA 1NE5A 1BRZA 1C56A 1TI5A 2N2RA 1NRBA 1BK8A 2MZ0A 1I6GA 5CY0A 1OZZA 1GPSA 1T0ZA 2LY6A 1JKZA 2NY8X 1FH3A 2LR3A 1LQHA 2ATBA 1NH5A 2LY5A 2YBRC 3E7UX 2LI7A 4V1DC 2SN3A 1PE4A 1ICAA 1KV0A 1PX9A 1BCGA 1LQIA 1N4NA 1WWNA 1ZYWA 1DJTA 1JZAA 4HE7A 1WMTA 1C55A 1DQ7A 1I2UA 1T7BA 1AHOA 1NRAA 2M8BB 1GPTA 2N66A 2KJAA 1BMRA 1CHZA 1P0AA 2LKBA 1LQQA 2LJ7A 1L4VA 4UJ0A 1PTXA 1P00A 2KPYA 2NY9X 1SNBA 2KBJA 1ZU3A 5KK4A 2YEOA 4KYPA 1I2VA 2E0HA 2N69A 2N2QA 1T7AA 4AEIA 1VNBA 2GL1A 4AAZA 2E3GA 1T7EA 1CN2A 4CQKA 2E3FA 1SN1A 4AB0A 2I61A 1I6FA 1WT7A 1JXCA 2KSKA 3E7RL 2LT8A 1SEGA 1ZVGA 1SN4A 1T1TA 1VNAA 1JZBA 1AYJA 1ZUTA 3PSMA 2B68A 1B3CA 2YC1C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KBK A;  2BRZ A;  1MR4 A;  2ASC A;  2B3C A;  1MYN A;  2KYQ A;  1ZFU A;  2KBH A;  2KGQ A;  4HHF A;  2LJM A;  1B7D A;  1NPI A;  1ZVE A;  2A7T A;  1ZYV A;  1OMY A;  1NE5 A;  1BRZ A;  1C56 A;  1TI5 A;  2N2R A;  1NRB A;  1BK8 A;  2MZ0 A;  1I6G A;  5CY0 A;  1OZZ A;  1GPS A;  1T0Z A;  2LY6 A;  1JKZ A;  2NY8 X;  1FH3 A;  2LR3 A;  1LQH A;  2ATB A;  1NH5 A;  2LY5 A;  2YBR C;  3E7U X;  2LI7 A;  4V1D C;  2SN3 A;  1PE4 A;  1ICA A;  1KV0 A;  1PX9 A;  1BCG A;  1LQI A;  1N4N A;  1WWN A;  1ZYW A;  1DJT A;  1JZA A;  4HE7 A;  1WMT A;  1C55 A;  1DQ7 A;  1I2U A;  1T7B A;  1AHO A;  1NRA A;  2M8B B;  1GPT A;  2N66 A;  2KJA A;  1BMR A;  1CHZ A;  1P0A A;  2LKB A;  1LQQ A;  2LJ7 A;  1L4V A;  4UJ0 A;  1PTX A;  1P00 A;  2KPY A;  2NY9 X;  1SNB A;  2KBJ A;  1ZU3 A;  5KK4 A;  2YEO A;  4KYP A;  1I2V A;  2E0H A;  2N69 A;  2N2Q A;  1T7A A;  4AEI A;  1VNB A;  2GL1 A;  4AAZ A;  2E3G A;  1T7E A;  1CN2 A;  4CQK A;  2E3F A;  1SN1 A;  4AB0 A;  2I61 A;  1I6F A;  1WT7 A;  1JXC A;  2KSK A;  3E7R L;  2LT8 A;  1SEG A;  1ZVG A;  1SN4 A;  1T1T A;  1VNA A;  1JZB A;  1AYJ A;  1ZUT A;  3PSM A;  2B68 A;  1B3C A;  2YC1 C; 
#chains in the Genus database with same CATH topology
 5AQG A;  2JDQ D;  2KBK A;  1KAZ A;  2BRZ A;  3KHW A;  1NGI A;  1MR4 A;  2ASC A;  2B3C A;  1MYN A;  5AQK A;  2KYQ A;  2QWQ A;  3R2V A;  1ZFU A;  2KBH A;  3KVG A;  1HJO A;  2KGQ A;  4H5R A;  4HHF A;  2LJM A;  3L4I A;  1B7D A;  5F1X A;  5AQZ A;  1NPI A;  1ZVE A;  1NGH A;  2A7T A;  3D2F B;  1QQN A;  1ZYV A;  1OMY A;  3GL1 A;  4GNI A;  3KOX A;  3FE1 A;  5FPD A;  1NGG A;  1NE5 A;  1BRZ A;  1C56 A;  1XRS B;  1TI5 A;  4H5V A;  4HWI A;  2N2R A;  5AQF A;  1NRB A;  3AY9 A;  5AQL A;  1DKG D;  3BK3 C;  3IUC A;  3QFP A;  4H5T A;  4H5N A;  1BK8 A;  2MZ0 A;  1I6G A;  5CY0 A;  5BN8 A;  3C7N A;  1OZZ A;  3LDO A;  1GPS A;  5AQR A;  1T0Z A;  2LY6 A;  3LDP A;  1HPM A;  1JKZ A;  2NY8 X;  1NGJ A;  5AQQ A;  4FL9 A;  5AQH A;  1FH3 A;  2YIL A;  5AQX A;  2LR3 A;  2YIP A;  1LQH A;  2ATB A;  1NH5 A;  2LY5 A;  3KP1 A;  1BA1 A;  5EVZ A;  1NGD A;  2YBR C;  3E7U X;  3HSC A;  3L6Q A;  2LI7 A;  1NGB A;  5AQV A;  2E2F A;  2E8A A;  2QWM A;  3KOY A;  4V1D C;  2SN3 A;  1PE4 A;  4H5W A;  4KBO A;  4UAF E;  1ICA A;  1KV0 A;  1PX9 A;  2QWR A;  3FZF A;  3C7N B;  1BCG A;  1BUP A;  2YIO A;  1LQI A;  5AQM A;  5BPL A;  1N4N A;  1WWN A;  3ATU A;  5BPM A;  1ZYW A;  1DJT A;  1JZA A;  4HE7 A;  1NGA A;  1YUW A;  3FZM A;  1WMT A;  1C55 A;  1DQ7 A;  3QFU A;  1T7B A;  1AHO A;  1NRA A;  2M8B B;  5AQS A;  5EXW A;  1GPT A;  1I2U A;  2N66 A;  3KP0 A;  2BUP A;  2KJA A;  5EX5 A;  1ATR A;  1CHZ A;  1P0A A;  3D2E A;  4UAE F;  1BMR A;  2MN5 A;  3JXU A;  3KOW A;  1KAX A;  2LKB A;  5AQJ A;  5AQW A;  5BPN A;  1LQQ A;  3CQX A;  1NGE A;  1ATS A;  2G2K A;  2LJ7 A;  5F0X A;  1L4V A;  4UJ0 A;  1PTX A;  5AQI A;  1P00 A;  5AQN A;  2QWL A;  2K35 A;  5FPN A;  2KPY A;  2NY9 X;  1SNB A;  2KBJ A;  2QWO A;  1ZU3 A;  3FZK A;  2LN8 A;  2YEO A;  1QQO A;  3L56 A;  4KYP A;  5AQT A;  5BN9 A;  5KK4 A;  1I2V A;  1NGF A;  2E0H A;  2N69 A;  2N2Q A;  4IO8 A;  3LDN A;  1T7A A;  4UAD E;  3QI7 A;  3A8Y A;  4AEI A;  3I33 A;  1VNB A;  2GL1 A;  3FZH A;  4AAZ A;  3D2E B;  5F2R A;  2E3G A;  1T7E A;  2D56 A;  1S3X A;  5EY4 A;  5FPE A;  1CN2 A;  2KHO A;  4CQK A;  3KC6 A;  3GKU A;  2E3F A;  2GMO A;  3LDL A;  3SF4 D;  1SN1 A;  1K8B A;  3QML A;  4AB0 A;  3GDQ A;  2QWP A;  2V7Z A;  3ATV A;  2MBK A;  2I61 A;  1UGL A;  1I6F A;  1WT7 A;  3M3Z A;  2QXL A;  3KOZ A;  1HX1 A;  2E88 A;  1JXC A;  1KAY A;  5AQU A;  2KSK A;  5AR0 A;  3D2F A;  3CW4 A;  3E7R L;  2LT8 A;  2QW9 A;  5AQP A;  1SEG A;  1ZVG A;  1QQM A;  1SN4 A;  1BA0 A;  1T1T A;  1VNA A;  5AQY A;  2VY6 A;  1JZB A;  1AYJ A;  4FSV A;  2QWN A;  1POI A;  1ZUT A;  3PSM A;  1NGC A;  3FZL A;  3LDQ A;  2B68 A;  1B3C A;  2YC1 C;  5FPM A;  5AQO A; 
#chains in the Genus database with same CATH homology
 2KBK A;  2BRZ A;  1MR4 A;  2ASC A;  2B3C A;  1MYN A;  2KYQ A;  1ZFU A;  2KBH A;  2KGQ A;  4HHF A;  2LJM A;  1B7D A;  1NPI A;  1ZVE A;  2A7T A;  1ZYV A;  1OMY A;  1NE5 A;  1BRZ A;  1C56 A;  1TI5 A;  2N2R A;  1NRB A;  1BK8 A;  2MZ0 A;  1I6G A;  5CY0 A;  1OZZ A;  1GPS A;  1T0Z A;  2LY6 A;  1JKZ A;  2NY8 X;  1FH3 A;  2LR3 A;  1LQH A;  2ATB A;  1NH5 A;  2LY5 A;  2YBR C;  3E7U X;  2LI7 A;  4V1D C;  2SN3 A;  1PE4 A;  1ICA A;  1KV0 A;  1PX9 A;  1BCG A;  1LQI A;  1N4N A;  1WWN A;  1ZYW A;  1DJT A;  1JZA A;  4HE7 A;  1WMT A;  1C55 A;  1DQ7 A;  1I2U A;  1T7B A;  1AHO A;  1NRA A;  2M8B B;  1GPT A;  2N66 A;  2KJA A;  1BMR A;  1CHZ A;  1P0A A;  2LKB A;  1LQQ A;  2LJ7 A;  1L4V A;  4UJ0 A;  1PTX A;  1P00 A;  2KPY A;  2NY9 X;  1SNB A;  2KBJ A;  1ZU3 A;  5KK4 A;  2YEO A;  4KYP A;  1I2V A;  2E0H A;  2N69 A;  2N2Q A;  1T7A A;  4AEI A;  1VNB A;  2GL1 A;  4AAZ A;  2E3G A;  1T7E A;  1CN2 A;  4CQK A;  2E3F A;  1SN1 A;  4AB0 A;  2I61 A;  1I6F A;  1WT7 A;  1JXC A;  2KSK A;  3E7R L;  2LT8 A;  1SEG A;  1ZVG A;  1SN4 A;  1T1T A;  1VNA A;  1JZB A;  1AYJ A;  1ZUT A;  3PSM A;  2B68 A;  1B3C A;  2YC1 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...