1T7AA

Crystal structure of mutant lys8asp of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
66
structure length
66
Chain Sequence
NSVRDAYIADPHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Alpha-like neurotoxin BmK-I
publication title Structural Mechanism Governing Cis and Trans Isomeric States and an Intramolecular Switch for Cis/Trans Isomerization of a Non-proline Peptide Bond Observed in Crystal Structures of Scorpion Toxins
pubmed doi rcsb
source organism Mesobuthus martensii
total genus 18
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1t7aA00
5KK4A 1JKZA 2KBKA 1ZVEA 2NY8X 2YBRC 2LT8A 2E3GA 4CQKA 2LY5A 1B7DA 2N2RA 1MR4A 2KPYA 1L4VA 1CHZA 2KYQA 2KBHA 1DQ7A 2LR3A 1C56A 2KGQA 2ATBA 1SN4A 1BMRA 1CN2A 1LQIA 2B68A 1TI5A 2LY6A 1GPTA 1NE5A 1I2VA 4V1DC 1OZZA 1WWNA 1I6GA 1B3CA 1JXCA 2MZ0A 2M8BB 1BK8A 5CY0A 1VNAA 2YC1C 2BRZA 1I6FA 2B3CA 2N2QA 2SN3A 1PE4A 3E7RL 3PSMA 1BRZA 1SN1A 1P00A 1SNBA 1ICAA 1JZBA 1OMYA 4KYPA 1C55A 2N66A 1T0ZA 1AYJA 2N69A 1MYNA 1LQQA 2LKBA 1ZYWA 2E3FA 2LJMA 1GPSA 1VNBA 1WMTA 2KSKA 1WT7A 1T7EA 4AB0A 1JZAA 2I61A 1ZVGA 4UJ0A 1ZU3A 4AEIA 1T7AA 2YEOA 2NY9X 1KV0A 2KBJA 2GL1A 1SEGA 2KJAA 1P0AA 1PTXA 1NRAA 1DJTA 2LI7A 1T7BA 2LJ7A 4HHFA 2A7TA 4AAZA 1ZFUA 4HE7A 1FH3A 1LQHA 1PX9A 1BCGA 3E7UX 1NRBA 1N4NA 1NH5A 1T1TA 1NPIA 1ZYVA 2E0HA 2ASCA 1ZUTA 1I2UA 1AHOA
chains in the Genus database with same CATH superfamily
1QQMA 5KK4A 1C55A 2E8AA 1JKZA 2QWMA 2KBKA 1ZVEA 5FPNA 2NY8X 3D2EA 2YBRC 3KP0A 3FE1A 2LT8A 1NGJA 2E3GA 3C7NA 3LDPA 3FZMA 3KOYA 4CQKA 2LY5A 1B7DA 2N2RA 1MR4A 1HJOA 3KHWA 2KPYA 1L4VA 3HSCA 2BUPA 1CHZA 2KYQA 3FZKA 5AQYA 2QWNA 5FPDA 3GKUA 5F0XA 2KBHA 1DQ7A 2LR3A 2QWOA 2YIPA 3QI7A 1C56A 2QWLA 2KGQA 3M3ZA 2ATBA 3L6QA 5AQOA 1SN4A 3D2FA 1BMRA 4UADE 1CN2A 1KAYA 3CQXA 2VY6A 3GDQA 5BN9A 3CW4A 5BN8A 1LQIA 1NGDA 2B68A 5AQKA 1BA1A 1TI5A 2LY6A 3I33A 5AQNA 1NE5A 1GPTA 1I2VA 3FZLA 4V1DC 1OZZA 1WWNA 2QWQA 1I6GA 4H5VA 1B3CA 1JXCA 1NGHA 1NGFA 1XRSB 2KHOA 2M8BB 2MZ0A 3QFPA 4GNIA 2D56A 5AQRA 2QXLA 4H5TA 3BK3C 3KVGA 1BK8A 5CY0A 2K35A 5AQWA 1HPMA 3L56A 2V7ZA 2QW9A 1VNAA 2YC1C 2BRZA 1NGBA 3KP1A 3LDOA 1I6FA 2YILA 2B3CA 2N2QA 2SN3A 1PE4A 3E7RL 2JDQD 2LN8A 3PSMA 4FSVA 5BPLA 1BRZA 1SN1A 1P00A 1NGEA 1SNBA 5F1XA 5FPMA 4UAEF 1ICAA 3KC6A 5F2RA 5EVZA 5EXWA 1JZBA 5AQIA 1UGLA 1OMYA 3D2FB 4KYPA 4KBOA 2N66A 1T0ZA 5AQPA 2YIOA 1KAXA 3A8YA 3IUCA 1S3XA 4IO8A 5AQQA 2N69A 3FZHA 5AQTA 1AYJA 1MYNA 1LQQA 2LKBA 1HX1A 1ZYWA 5AQXA 2E3FA 3R2VA 2LJMA 1ATRA 1BA0A 1POIA 5FPEA 1GPSA 1VNBA 1K8BA 1DKGD 1WMTA 2E2FA 3D2EB 2KSKA 1WT7A 3QMLA 4H5RA 1T7EA 4AB0A 1JZAA 3C7NB 3SF4D 2I61A 1ZVGA 4UJ0A 4H5WA 1ATSA 4HWIA 1ZU3A 4AEIA 1T7AA 4UAFE 5AQSA 2YEOA 2NY9X 3KOXA 5AQLA 5BPMA 1YUWA 5EY4A 5AQUA 1KV0A 2KBJA 2E88A 3FZFA 2GL1A 1SEGA 5AQGA 2KJAA 1QQOA 1P0AA 2G2KA 5BPNA 1PTXA 5AQZA 1NRAA 1DJTA 2LI7A 3L4IA 5AQHA 1T7BA 2LJ7A 4HHFA 3ATUA 3ATVA 5AQVA 5AQJA 2A7TA 2QWRA 1NGAA 3LDQA 2MBKA 5AQFA 4FL9A 5AQMA 4AAZA 1ZFUA 4HE7A 1FH3A 1NGCA 3AY9A 3GL1A 1LQHA 1PX9A 1BCGA 3E7UX 1NRBA 2MN5A 3KOWA 3LDLA 3QFUA 1QQNA 1N4NA 2GMOA 1NH5A 5AR0A 5EX5A 1T1TA 4H5NA 3LDNA 1NGIA 1NPIA 3JXUA 1ZYVA 2E0HA 2QWPA 2ASCA 1ZUTA 1I2UA 1NGGA 1KAZA 1AHOA 3KOZA 1BUPA
chains in the Genus database with same CATH topology
5KK4A 1JKZA 2KBKA 1ZVEA 2NY8X 2YBRC 2LT8A 2E3GA 4CQKA 2LY5A 1B7DA 2N2RA 1MR4A 2KPYA 1L4VA 1CHZA 2KYQA 2KBHA 1DQ7A 2LR3A 1C56A 2KGQA 2ATBA 1SN4A 1BMRA 1CN2A 1LQIA 2B68A 1TI5A 2LY6A 1GPTA 1NE5A 1I2VA 4V1DC 1OZZA 1WWNA 1I6GA 1B3CA 1JXCA 2MZ0A 2M8BB 1BK8A 5CY0A 1VNAA 2YC1C 2BRZA 1I6FA 2B3CA 2N2QA 2SN3A 1PE4A 3E7RL 3PSMA 1BRZA 1SN1A 1P00A 1SNBA 1ICAA 1JZBA 1OMYA 4KYPA 1C55A 2N66A 1T0ZA 1AYJA 2N69A 1MYNA 1LQQA 2LKBA 1ZYWA 2E3FA 2LJMA 1GPSA 1VNBA 1WMTA 2KSKA 1WT7A 1T7EA 4AB0A 1JZAA 2I61A 1ZVGA 4UJ0A 1ZU3A 4AEIA 1T7AA 2YEOA 2NY9X 1KV0A 2KBJA 2GL1A 1SEGA 2KJAA 1P0AA 1PTXA 1NRAA 1DJTA 2LI7A 1T7BA 2LJ7A 4HHFA 2A7TA 4AAZA 1ZFUA 4HE7A 1FH3A 1LQHA 1PX9A 1BCGA 3E7UX 1NRBA 1N4NA 1NH5A 1T1TA 1NPIA 1ZYVA 2E0HA 2ASCA 1ZUTA 1I2UA 1AHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KK4 A;  1JKZ A;  2KBK A;  1ZVE A;  2NY8 X;  2YBR C;  2LT8 A;  2E3G A;  4CQK A;  2LY5 A;  1B7D A;  2N2R A;  1MR4 A;  2KPY A;  1L4V A;  1CHZ A;  2KYQ A;  2KBH A;  1DQ7 A;  2LR3 A;  1C56 A;  2KGQ A;  2ATB A;  1SN4 A;  1BMR A;  1CN2 A;  1LQI A;  2B68 A;  1TI5 A;  2LY6 A;  1GPT A;  1NE5 A;  1I2V A;  4V1D C;  1OZZ A;  1WWN A;  1I6G A;  1B3C A;  1JXC A;  2MZ0 A;  2M8B B;  1BK8 A;  5CY0 A;  1VNA A;  2YC1 C;  2BRZ A;  1I6F A;  2B3C A;  2N2Q A;  2SN3 A;  1PE4 A;  3E7R L;  3PSM A;  1BRZ A;  1SN1 A;  1P00 A;  1SNB A;  1ICA A;  1JZB A;  1OMY A;  4KYP A;  1C55 A;  2N66 A;  1T0Z A;  1AYJ A;  2N69 A;  1MYN A;  1LQQ A;  2LKB A;  1ZYW A;  2E3F A;  2LJM A;  1GPS A;  1VNB A;  1WMT A;  2KSK A;  1WT7 A;  1T7E A;  4AB0 A;  1JZA A;  2I61 A;  1ZVG A;  4UJ0 A;  1ZU3 A;  4AEI A;  1T7A A;  2YEO A;  2NY9 X;  1KV0 A;  2KBJ A;  2GL1 A;  1SEG A;  2KJA A;  1P0A A;  1PTX A;  1NRA A;  1DJT A;  2LI7 A;  1T7B A;  2LJ7 A;  4HHF A;  2A7T A;  4AAZ A;  1ZFU A;  4HE7 A;  1FH3 A;  1LQH A;  1PX9 A;  1BCG A;  3E7U X;  1NRB A;  1N4N A;  1NH5 A;  1T1T A;  1NPI A;  1ZYV A;  2E0H A;  2ASC A;  1ZUT A;  1I2U A;  1AHO A; 
#chains in the Genus database with same CATH topology
 1QQM A;  5KK4 A;  1C55 A;  2E8A A;  1JKZ A;  2QWM A;  2KBK A;  1ZVE A;  5FPN A;  2NY8 X;  3D2E A;  2YBR C;  3KP0 A;  3FE1 A;  2LT8 A;  1NGJ A;  2E3G A;  3C7N A;  3LDP A;  3FZM A;  3KOY A;  4CQK A;  2LY5 A;  1B7D A;  2N2R A;  1MR4 A;  1HJO A;  3KHW A;  2KPY A;  1L4V A;  3HSC A;  2BUP A;  1CHZ A;  2KYQ A;  3FZK A;  5AQY A;  2QWN A;  5FPD A;  3GKU A;  5F0X A;  2KBH A;  1DQ7 A;  2LR3 A;  2QWO A;  2YIP A;  3QI7 A;  1C56 A;  2QWL A;  2KGQ A;  3M3Z A;  2ATB A;  3L6Q A;  5AQO A;  1SN4 A;  3D2F A;  1BMR A;  4UAD E;  1CN2 A;  1KAY A;  3CQX A;  2VY6 A;  3GDQ A;  5BN9 A;  3CW4 A;  5BN8 A;  1LQI A;  1NGD A;  2B68 A;  5AQK A;  1BA1 A;  1TI5 A;  2LY6 A;  3I33 A;  5AQN A;  1NE5 A;  1GPT A;  1I2V A;  3FZL A;  4V1D C;  1OZZ A;  1WWN A;  2QWQ A;  1I6G A;  4H5V A;  1B3C A;  1JXC A;  1NGH A;  1NGF A;  1XRS B;  2KHO A;  2M8B B;  2MZ0 A;  3QFP A;  4GNI A;  2D56 A;  5AQR A;  2QXL A;  4H5T A;  3BK3 C;  3KVG A;  1BK8 A;  5CY0 A;  2K35 A;  5AQW A;  1HPM A;  3L56 A;  2V7Z A;  2QW9 A;  1VNA A;  2YC1 C;  2BRZ A;  1NGB A;  3KP1 A;  3LDO A;  1I6F A;  2YIL A;  2B3C A;  2N2Q A;  2SN3 A;  1PE4 A;  3E7R L;  2JDQ D;  2LN8 A;  3PSM A;  4FSV A;  5BPL A;  1BRZ A;  1SN1 A;  1P00 A;  1NGE A;  1SNB A;  5F1X A;  5FPM A;  4UAE F;  1ICA A;  3KC6 A;  5F2R A;  5EVZ A;  5EXW A;  1JZB A;  5AQI A;  1UGL A;  1OMY A;  3D2F B;  4KYP A;  4KBO A;  2N66 A;  1T0Z A;  5AQP A;  2YIO A;  1KAX A;  3A8Y A;  3IUC A;  1S3X A;  4IO8 A;  5AQQ A;  2N69 A;  3FZH A;  5AQT A;  1AYJ A;  1MYN A;  1LQQ A;  2LKB A;  1HX1 A;  1ZYW A;  5AQX A;  2E3F A;  3R2V A;  2LJM A;  1ATR A;  1BA0 A;  1POI A;  5FPE A;  1GPS A;  1VNB A;  1K8B A;  1DKG D;  1WMT A;  2E2F A;  3D2E B;  2KSK A;  1WT7 A;  3QML A;  4H5R A;  1T7E A;  4AB0 A;  1JZA A;  3C7N B;  3SF4 D;  2I61 A;  1ZVG A;  4UJ0 A;  4H5W A;  1ATS A;  4HWI A;  1ZU3 A;  4AEI A;  1T7A A;  4UAF E;  5AQS A;  2YEO A;  2NY9 X;  3KOX A;  5AQL A;  5BPM A;  1YUW A;  5EY4 A;  5AQU A;  1KV0 A;  2KBJ A;  2E88 A;  3FZF A;  2GL1 A;  1SEG A;  5AQG A;  2KJA A;  1QQO A;  1P0A A;  2G2K A;  5BPN A;  1PTX A;  5AQZ A;  1NRA A;  1DJT A;  2LI7 A;  3L4I A;  5AQH A;  1T7B A;  2LJ7 A;  4HHF A;  3ATU A;  3ATV A;  5AQV A;  5AQJ A;  2A7T A;  2QWR A;  1NGA A;  3LDQ A;  2MBK A;  5AQF A;  4FL9 A;  5AQM A;  4AAZ A;  1ZFU A;  4HE7 A;  1FH3 A;  1NGC A;  3AY9 A;  3GL1 A;  1LQH A;  1PX9 A;  1BCG A;  3E7U X;  1NRB A;  2MN5 A;  3KOW A;  3LDL A;  3QFU A;  1QQN A;  1N4N A;  2GMO A;  1NH5 A;  5AR0 A;  5EX5 A;  1T1T A;  4H5N A;  3LDN A;  1NGI A;  1NPI A;  3JXU A;  1ZYV A;  2E0H A;  2QWP A;  2ASC A;  1ZUT A;  1I2U A;  1NGG A;  1KAZ A;  1AHO A;  3KOZ A;  1BUP A; 
#chains in the Genus database with same CATH homology
 5KK4 A;  1JKZ A;  2KBK A;  1ZVE A;  2NY8 X;  2YBR C;  2LT8 A;  2E3G A;  4CQK A;  2LY5 A;  1B7D A;  2N2R A;  1MR4 A;  2KPY A;  1L4V A;  1CHZ A;  2KYQ A;  2KBH A;  1DQ7 A;  2LR3 A;  1C56 A;  2KGQ A;  2ATB A;  1SN4 A;  1BMR A;  1CN2 A;  1LQI A;  2B68 A;  1TI5 A;  2LY6 A;  1GPT A;  1NE5 A;  1I2V A;  4V1D C;  1OZZ A;  1WWN A;  1I6G A;  1B3C A;  1JXC A;  2MZ0 A;  2M8B B;  1BK8 A;  5CY0 A;  1VNA A;  2YC1 C;  2BRZ A;  1I6F A;  2B3C A;  2N2Q A;  2SN3 A;  1PE4 A;  3E7R L;  3PSM A;  1BRZ A;  1SN1 A;  1P00 A;  1SNB A;  1ICA A;  1JZB A;  1OMY A;  4KYP A;  1C55 A;  2N66 A;  1T0Z A;  1AYJ A;  2N69 A;  1MYN A;  1LQQ A;  2LKB A;  1ZYW A;  2E3F A;  2LJM A;  1GPS A;  1VNB A;  1WMT A;  2KSK A;  1WT7 A;  1T7E A;  4AB0 A;  1JZA A;  2I61 A;  1ZVG A;  4UJ0 A;  1ZU3 A;  4AEI A;  1T7A A;  2YEO A;  2NY9 X;  1KV0 A;  2KBJ A;  2GL1 A;  1SEG A;  2KJA A;  1P0A A;  1PTX A;  1NRA A;  1DJT A;  2LI7 A;  1T7B A;  2LJ7 A;  4HHF A;  2A7T A;  4AAZ A;  1ZFU A;  4HE7 A;  1FH3 A;  1LQH A;  1PX9 A;  1BCG A;  3E7U X;  1NRB A;  1N4N A;  1NH5 A;  1T1T A;  1NPI A;  1ZYV A;  2E0H A;  2ASC A;  1ZUT A;  1I2U A;  1AHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...