2LN8A

The solution structure of theromacin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
GCFEDWSRCSPSTASATGVLWRSCDSYCKVCFKADRGECYDSPSLNCPHRLPNNKQCRCINARTAKDNRNPTCWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Theromacin
publication title Macin family of antimicrobial proteins combines antimicrobial and nerve repair activities.
pubmed doi rcsb
source organism Hirudo medicinalis
molecule tags Antimicrobial protein
total genus 24
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2011-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14865 Macin Macin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.100 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2ln8A00
2K35A 2LN8A
chains in the Genus database with same CATH superfamily
1TI5A 1PTXA 1WWNA 2E2FA 2QWLA 5AQYA 1BK8A 4H5WA 2V7ZA 3KP0A 5FPMA 1P00A 5EY4A 5AQWA 1CN2A 3E7UX 3JXUA 4FL9A 1P0AA 1NGFA 4HWIA 1BMRA 2QWNA 2QWQA 3FZLA 5F1XA 1C56A 1DQ7A 4H5VA 1ZVEA 1I6GA 1T1TA 1VNAA 3KVGA 3E7RL 3SF4D 3LDNA 2KYQA 4AEIA 1SEGA 5KK4A 1PX9A 2B3CA 5FPNA 1NGGA 1DJTA 1S3XA 1VNBA 1JZAA 2LN8A 3GDQA 3HSCA 1B3CA 3QI7A 5AQIA 1NRAA 4AAZA 5AQRA 2G2KA 2LJMA 3FZFA 5AQUA 2YC1C 2LR3A 4IO8A 1ICAA 2QW9A 2GL1A 1KAZA 1KAXA 1NPIA 3D2FA 3I33A 3C7NA 3KOXA 1AHOA 3R2VA 1NGDA 3D2EA 1ATRA 5FPDA 2BUPA 1LQHA 3ATUA 1BA1A 2K35A 5AQJA 5AQTA 2YILA 1MYNA 1ZYWA 2MZ0A 1ZFUA 2D56A 1ATSA 3LDQA 2E0HA 2M8BB 2KSKA 4FSVA 5AQLA 1BRZA 1QQOA 2KHOA 3A8YA 3FZHA 3GL1A 3AY9A 4KYPA 5EXWA 1NGIA 1OZZA 1NGAA 2LI7A 2KBKA 2B68A 1MR4A 1LQIA 1NH5A 2N66A 1LQQA 3GKUA 4UJ0A 5AQHA 5AQNA 2ASCA 4GNIA 2YIPA 2YIOA 2E88A 2KPYA 3KOYA 3KP1A 1ZUTA 1JKZA 2ATBA 4UAEF 4HHFA 1NGEA 1HPMA 3PSMA 2LT8A 1UGLA 2KGQA 1HJOA 1JXCA 5AQXA 5BN9A 3KOWA 3LDOA 4UAFE 5BPNA 5AQZA 5BPLA 1KV0A 3L4IA 2N2QA 3M3ZA 5AQSA 3FZKA 1NGBA 2YBRC 3L56A 5AQVA 1YUWA 1N4NA 1NGHA 2A7TA 2I61A 5AQGA 2KJAA 5AQKA 1L4VA 1FH3A 2VY6A 3FZMA 1CHZA 1BCGA 2E3FA 1I6FA 1SN4A 2JDQD 4H5NA 1ZVGA 3LDPA 4V1DC 4HE7A 3QFUA 5AQPA 2SN3A 3FE1A 5F0XA 3KC6A 1KAYA 2QWMA 1I2UA 4CQKA 2NY9X 2GMOA 1BA0A 2LKBA 5AQFA 5CY0A 2NY8X 1POIA 2BRZA 1ZU3A 3LDLA 5EVZA 1I2VA 2E3GA 4KBOA 2E8AA 1JZBA 1T7AA 2LJ7A 3BK3C 2MN5A 5AQOA 5BPMA 1BUPA 4H5RA 2LY5A 1QQNA 5F2RA 1HX1A 1NRBA 1T7EA 1T7BA 2MBKA 1DKGD 1NGJA 2N2RA 3KHWA 3CQXA 3KOZA 1SN1A 1GPTA 1PE4A 1B7DA 4H5TA 2QWRA 2QWPA 5AR0A 5EX5A 1NE5A 3D2FB 3C7NB 2KBHA 2QWOA 2KBJA 3ATVA 5FPEA 1QQMA 2N69A 3D2EB 1K8BA 1NGCA 1WMTA 3QMLA 3IUCA 3QFPA 1C55A 1OMYA 4UADE 5AQQA 3L6QA 1XRSB 2YEOA 4AB0A 2QXLA 3CW4A 1AYJA 1WT7A 1SNBA 1GPSA 1ZYVA 2LY6A 5BN8A 5AQMA 1T0ZA
chains in the Genus database with same CATH topology
2E2FA 2QWLA 5AQYA 4H5WA 2V7ZA 5FPMA 5EY4A 5AQWA 3JXUA 4FL9A 1NGFA 4HWIA 2QWNA 2QWQA 3FZLA 5F1XA 4H5VA 3KVGA 3SF4D 3LDNA 5FPNA 1NGGA 1S3XA 2LN8A 3GDQA 3HSCA 3QI7A 5AQIA 5AQRA 3FZFA 5AQUA 4IO8A 2QW9A 1KAZA 1KAXA 3D2FA 3I33A 3C7NA 3R2VA 1NGDA 3D2EA 1ATRA 5FPDA 2BUPA 3ATUA 1BA1A 2K35A 5AQJA 5AQTA 2YILA 2D56A 1ATSA 3LDQA 4FSVA 5AQLA 1QQOA 2KHOA 3A8YA 3FZHA 3GL1A 3AY9A 5EXWA 1NGIA 1NGAA 5AQHA 5AQNA 4GNIA 2YIOA 2E88A 4UAEF 1NGEA 1HPMA 5AQXA 1HJOA 5BN9A 3LDOA 4UAFE 5BPNA 5AQZA 5BPLA 3L4IA 3M3ZA 5AQSA 3FZKA 1NGBA 3L56A 5AQVA 1YUWA 1NGHA 5AQGA 5AQKA 2VY6A 3FZMA 2JDQD 4H5NA 3LDPA 3QFUA 5AQPA 5F0XA 3FE1A 3KC6A 1KAYA 2QWMA 2GMOA 1BA0A 5AQFA 1POIA 3LDLA 5EVZA 4KBOA 2E8AA 3BK3C 2MN5A 5AQOA 5BPMA 1BUPA 4H5RA 5F2RA 1QQNA 1HX1A 3KHWA 2MBKA 1DKGD 1NGJA 3CQXA 4H5TA 2QWRA 2QWPA 5AR0A 5EX5A 3D2FB 3C7NB 2QWOA 3ATVA 5FPEA 1QQMA 3D2EB 1NGCA 3QMLA 3IUCA 3QFPA 4UADE 5AQQA 3L6QA 2QXLA 3CW4A 2YIPA 5BN8A 5AQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K35 A;  2LN8 A; 
#chains in the Genus database with same CATH topology
 1TI5 A;  1PTX A;  1WWN A;  2E2F A;  2QWL A;  5AQY A;  1BK8 A;  4H5W A;  2V7Z A;  3KP0 A;  5FPM A;  1P00 A;  5EY4 A;  5AQW A;  1CN2 A;  3E7U X;  3JXU A;  4FL9 A;  1P0A A;  1NGF A;  4HWI A;  1BMR A;  2QWN A;  2QWQ A;  3FZL A;  5F1X A;  1C56 A;  1DQ7 A;  4H5V A;  1ZVE A;  1I6G A;  1T1T A;  1VNA A;  3KVG A;  3E7R L;  3SF4 D;  3LDN A;  2KYQ A;  4AEI A;  1SEG A;  5KK4 A;  1PX9 A;  2B3C A;  5FPN A;  1NGG A;  1DJT A;  1S3X A;  1VNB A;  1JZA A;  2LN8 A;  3GDQ A;  3HSC A;  1B3C A;  3QI7 A;  5AQI A;  1NRA A;  4AAZ A;  5AQR A;  2G2K A;  2LJM A;  3FZF A;  5AQU A;  2YC1 C;  2LR3 A;  4IO8 A;  1ICA A;  2QW9 A;  2GL1 A;  1KAZ A;  1KAX A;  1NPI A;  3D2F A;  3I33 A;  3C7N A;  3KOX A;  1AHO A;  3R2V A;  1NGD A;  3D2E A;  1ATR A;  5FPD A;  2BUP A;  1LQH A;  3ATU A;  1BA1 A;  2K35 A;  5AQJ A;  5AQT A;  2YIL A;  1MYN A;  1ZYW A;  2MZ0 A;  1ZFU A;  2D56 A;  1ATS A;  3LDQ A;  2E0H A;  2M8B B;  2KSK A;  4FSV A;  5AQL A;  1BRZ A;  1QQO A;  2KHO A;  3A8Y A;  3FZH A;  3GL1 A;  3AY9 A;  4KYP A;  5EXW A;  1NGI A;  1OZZ A;  1NGA A;  2LI7 A;  2KBK A;  2B68 A;  1MR4 A;  1LQI A;  1NH5 A;  2N66 A;  1LQQ A;  3GKU A;  4UJ0 A;  5AQH A;  5AQN A;  2ASC A;  4GNI A;  2YIP A;  2YIO A;  2E88 A;  2KPY A;  3KOY A;  3KP1 A;  1ZUT A;  1JKZ A;  2ATB A;  4UAE F;  4HHF A;  1NGE A;  1HPM A;  3PSM A;  2LT8 A;  1UGL A;  2KGQ A;  1HJO A;  1JXC A;  5AQX A;  5BN9 A;  3KOW A;  3LDO A;  4UAF E;  5BPN A;  5AQZ A;  5BPL A;  1KV0 A;  3L4I A;  2N2Q A;  3M3Z A;  5AQS A;  3FZK A;  1NGB A;  2YBR C;  3L56 A;  5AQV A;  1YUW A;  1N4N A;  1NGH A;  2A7T A;  2I61 A;  5AQG A;  2KJA A;  5AQK A;  1L4V A;  1FH3 A;  2VY6 A;  3FZM A;  1CHZ A;  1BCG A;  2E3F A;  1I6F A;  1SN4 A;  2JDQ D;  4H5N A;  1ZVG A;  3LDP A;  4V1D C;  4HE7 A;  3QFU A;  5AQP A;  2SN3 A;  3FE1 A;  5F0X A;  3KC6 A;  1KAY A;  2QWM A;  1I2U A;  4CQK A;  2NY9 X;  2GMO A;  1BA0 A;  2LKB A;  5AQF A;  5CY0 A;  2NY8 X;  1POI A;  2BRZ A;  1ZU3 A;  3LDL A;  5EVZ A;  1I2V A;  2E3G A;  4KBO A;  2E8A A;  1JZB A;  1T7A A;  2LJ7 A;  3BK3 C;  2MN5 A;  5AQO A;  5BPM A;  1BUP A;  4H5R A;  2LY5 A;  1QQN A;  5F2R A;  1HX1 A;  1NRB A;  1T7E A;  1T7B A;  2MBK A;  1DKG D;  1NGJ A;  2N2R A;  3KHW A;  3CQX A;  3KOZ A;  1SN1 A;  1GPT A;  1PE4 A;  1B7D A;  4H5T A;  2QWR A;  2QWP A;  5AR0 A;  5EX5 A;  1NE5 A;  3D2F B;  3C7N B;  2KBH A;  2QWO A;  2KBJ A;  3ATV A;  5FPE A;  1QQM A;  2N69 A;  3D2E B;  1K8B A;  1NGC A;  1WMT A;  3QML A;  3IUC A;  3QFP A;  1C55 A;  1OMY A;  4UAD E;  5AQQ A;  3L6Q A;  1XRS B;  2YEO A;  4AB0 A;  2QXL A;  3CW4 A;  1AYJ A;  1WT7 A;  1SNB A;  1GPS A;  1ZYV A;  2LY6 A;  5BN8 A;  5AQM A;  1T0Z A; 
#chains in the Genus database with same CATH homology
 2E2F A;  2QWL A;  5AQY A;  4H5W A;  2V7Z A;  5FPM A;  5EY4 A;  5AQW A;  3JXU A;  4FL9 A;  1NGF A;  4HWI A;  2QWN A;  2QWQ A;  3FZL A;  5F1X A;  4H5V A;  3KVG A;  3SF4 D;  3LDN A;  5FPN A;  1NGG A;  1S3X A;  2LN8 A;  3GDQ A;  3HSC A;  3QI7 A;  5AQI A;  5AQR A;  3FZF A;  5AQU A;  4IO8 A;  2QW9 A;  1KAZ A;  1KAX A;  3D2F A;  3I33 A;  3C7N A;  3R2V A;  1NGD A;  3D2E A;  1ATR A;  5FPD A;  2BUP A;  3ATU A;  1BA1 A;  2K35 A;  5AQJ A;  5AQT A;  2YIL A;  2D56 A;  1ATS A;  3LDQ A;  4FSV A;  5AQL A;  1QQO A;  2KHO A;  3A8Y A;  3FZH A;  3GL1 A;  3AY9 A;  5EXW A;  1NGI A;  1NGA A;  5AQH A;  5AQN A;  4GNI A;  2YIO A;  2E88 A;  4UAE F;  1NGE A;  1HPM A;  5AQX A;  1HJO A;  5BN9 A;  3LDO A;  4UAF E;  5BPN A;  5AQZ A;  5BPL A;  3L4I A;  3M3Z A;  5AQS A;  3FZK A;  1NGB A;  3L56 A;  5AQV A;  1YUW A;  1NGH A;  5AQG A;  5AQK A;  2VY6 A;  3FZM A;  2JDQ D;  4H5N A;  3LDP A;  3QFU A;  5AQP A;  5F0X A;  3FE1 A;  3KC6 A;  1KAY A;  2QWM A;  2GMO A;  1BA0 A;  5AQF A;  1POI A;  3LDL A;  5EVZ A;  4KBO A;  2E8A A;  3BK3 C;  2MN5 A;  5AQO A;  5BPM A;  1BUP A;  4H5R A;  5F2R A;  1QQN A;  1HX1 A;  3KHW A;  2MBK A;  1DKG D;  1NGJ A;  3CQX A;  4H5T A;  2QWR A;  2QWP A;  5AR0 A;  5EX5 A;  3D2F B;  3C7N B;  2QWO A;  3ATV A;  5FPE A;  1QQM A;  3D2E B;  1NGC A;  3QML A;  3IUC A;  3QFP A;  4UAD E;  5AQQ A;  3L6Q A;  2QXL A;  3CW4 A;  2YIP A;  5BN8 A;  5AQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...