2LN8A

The solution structure of theromacin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
GCFEDWSRCSPSTASATGVLWRSCDSYCKVCFKADRGECYDSPSLNCPHRLPNNKQCRCINARTAKDNRNPTCWA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Theromacin
publication title Macin family of antimicrobial proteins combines antimicrobial and nerve repair activities.
pubmed doi rcsb
source organism Hirudo medicinalis
total genus 24
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2011-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14865 Macin Macin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.100 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2ln8A00
2K35A 2LN8A
chains in the Genus database with same CATH superfamily
5F2RA 2NY9X 2M8BB 1KAYA 3R2VA 1WMTA 2QWQA 3KOWA 3FZLA 2QWMA 1ZU3A 2QWOA 1KAXA 2QWPA 3E7UX 2VY6A 1NH5A 5FPEA 2E3GA 5F1XA 5F0XA 5AQIA 5AQMA 1XRSB 2LY5A 2BUPA 3LDOA 3SF4D 2QWNA 2QWRA 4V1DC 1CHZA 2B68A 4KYPA 5BPMA 1PE4A 2LY6A 4H5VA 1BK8A 1WWNA 2YIPA 3QFUA 1MYNA 5AR0A 1UGLA 1ZUTA 2I61A 5AQQA 2K35A 3KVGA 1NGIA 3GKUA 3KP1A 3AY9A 3I33A 2G2KA 3D2EB 1POIA 5AQPA 2NY8X 1JXCA 4CQKA 2E3FA 4AEIA 1L4VA 1DKGD 3ATUA 3LDQA 5BN8A 4UAEF 4HWIA 1DQ7A 2KBHA 1QQOA 2N69A 3CW4A 4H5WA 1GPSA 5AQXA 2KBKA 2LKBA 5EY4A 1CN2A 3L4IA 1OMYA 1NGHA 1SN4A 1ZYWA 1SEGA 2JDQD 3E7RL 2D56A 3M3ZA 1JKZA 3LDPA 4FL9A 1NPIA 1I2UA 3FZHA 3PSMA 4AB0A 1BA0A 3D2FA 2GL1A 5FPMA 5AQUA 1GPTA 2N2RA 5BPNA 2QW9A 3GDQA 1HX1A 1NRAA 5AQFA 2V7ZA 1NGBA 3QFPA 2KHOA 5AQYA 1B3CA 4UAFE 4KBOA 1VNBA 5EX5A 1OZZA 2E8AA 2YIOA 1KV0A 5AQLA 3KOZA 3C7NA 1T0ZA 2BRZA 2N66A 3KC6A 1NGGA 4HHFA 1HPMA 1NGCA 1KAZA 2MZ0A 5BPLA 2MN5A 3FE1A 5FPNA 5AQNA 2KBJA 1ICAA 1SNBA 3L6QA 5FPDA 3KHWA 1QQMA 3QI7A 4H5RA 1NRBA 3BK3C 1BMRA 4IO8A 2KGQA 3GL1A 2LR3A 5AQTA 1JZBA 1NE5A 2LN8A 2B3CA 3KP0A 2YILA 4AAZA 3IUCA 2YBRC 1ATSA 1S3XA 5AQGA 3KOYA 1T7AA 3HSCA 3JXUA 4H5NA 4HE7A 1JZAA 3QMLA 1LQHA 1T1TA 5AQWA 1ZVGA 4UADE 1LQQA 1P00A 1T7BA 2QXLA 2YC1C 1TI5A 2A7TA 1NGEA 3LDNA 3FZMA 4FSVA 1PTXA 1MR4A 1NGAA 2ATBA 1DJTA 3FZKA 3D2EA 5CY0A 1HJOA 1BRZA 1VNAA 1BCGA 1T7EA 1WT7A 1AHOA 3FZFA 1NGJA 2ASCA 1B7DA 2SN3A 1NGDA 1QQNA 3LDLA 5BN9A 3D2FB 1ZYVA 1K8BA 5AQOA 2LI7A 2KSKA 1ZVEA 5KK4A 2MBKA 5AQSA 2KPYA 2LJ7A 2QWLA 1I6FA 1SN1A 1I6GA 3ATVA 4GNIA 1C55A 3KOXA 2KYQA 1C56A 5AQKA 4H5TA 2E88A 1AYJA 1NGFA 4UJ0A 5AQZA 2N2QA 2E0HA 2GMOA 2LJMA 1YUWA 2KJAA 3C7NB 5AQRA 5AQJA 1FH3A 1N4NA 1ATRA 1P0AA 1I2VA 1BA1A 5EXWA 1BUPA 1ZFUA 3L56A 2YEOA 3A8YA 5AQVA 1PX9A 5AQHA 5EVZA 2LT8A 2E2FA 1LQIA 3CQXA
chains in the Genus database with same CATH topology
5F2RA 3R2VA 1KAYA 2QWQA 3FZLA 2QWMA 2QWPA 2QWOA 1KAXA 2VY6A 5FPEA 5F1XA 5F0XA 5AQIA 5AQMA 3LDOA 2BUPA 3SF4D 2QWNA 2QWRA 5BPMA 4H5VA 2YIPA 3QFUA 5AR0A 5AQQA 2K35A 3KVGA 1NGIA 3AY9A 3I33A 3D2EB 1POIA 5AQPA 1DKGD 3ATUA 3LDQA 5BN8A 2E2FA 4UAEF 4HWIA 1QQOA 3CW4A 4H5WA 5AQXA 5EY4A 3L4IA 3M3ZA 1NGHA 2JDQD 2D56A 3LDPA 4FL9A 3FZHA 1BA0A 3D2FA 5FPMA 5AQUA 5BPNA 2QW9A 3GDQA 1HX1A 5AQFA 2V7ZA 1NGBA 3QFPA 2KHOA 5AQYA 4UAFE 4KBOA 5EX5A 2E8AA 2YIOA 5AQLA 3C7NA 3KC6A 1NGGA 1HPMA 1NGCA 1KAZA 5BPLA 2MN5A 3FE1A 5FPNA 5AQNA 3L6QA 5FPDA 3KHWA 1QQMA 3QI7A 4H5RA 3BK3C 4IO8A 3GL1A 5AQTA 2LN8A 2YILA 3IUCA 1ATSA 1S3XA 5AQGA 3HSCA 3JXUA 4H5NA 5AQWA 3QMLA 4UADE 2QXLA 1NGEA 3LDNA 3FZMA 4FSVA 1NGAA 3FZKA 3D2EA 1HJOA 3FZFA 1NGJA 1NGDA 1QQNA 3LDLA 5BN9A 3D2FB 5AQOA 2MBKA 5AQSA 2QWLA 3ATVA 4GNIA 5AQKA 4H5TA 2E88A 1NGFA 5AQZA 2GMOA 3C7NB 5AQRA 1YUWA 5AQJA 1ATRA 1BA1A 5EXWA 1BUPA 3L56A 5AQVA 5AQHA 5EVZA 3A8YA 3CQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K35 A;  2LN8 A; 
#chains in the Genus database with same CATH topology
 5F2R A;  2NY9 X;  2M8B B;  1KAY A;  3R2V A;  1WMT A;  2QWQ A;  3KOW A;  3FZL A;  2QWM A;  1ZU3 A;  2QWO A;  1KAX A;  2QWP A;  3E7U X;  2VY6 A;  1NH5 A;  5FPE A;  2E3G A;  5F1X A;  5F0X A;  5AQI A;  5AQM A;  1XRS B;  2LY5 A;  2BUP A;  3LDO A;  3SF4 D;  2QWN A;  2QWR A;  4V1D C;  1CHZ A;  2B68 A;  4KYP A;  5BPM A;  1PE4 A;  2LY6 A;  4H5V A;  1BK8 A;  1WWN A;  2YIP A;  3QFU A;  1MYN A;  5AR0 A;  1UGL A;  1ZUT A;  2I61 A;  5AQQ A;  2K35 A;  3KVG A;  1NGI A;  3GKU A;  3KP1 A;  3AY9 A;  3I33 A;  2G2K A;  3D2E B;  1POI A;  5AQP A;  2NY8 X;  1JXC A;  4CQK A;  2E3F A;  4AEI A;  1L4V A;  1DKG D;  3ATU A;  3LDQ A;  5BN8 A;  4UAE F;  4HWI A;  1DQ7 A;  2KBH A;  1QQO A;  2N69 A;  3CW4 A;  4H5W A;  1GPS A;  5AQX A;  2KBK A;  2LKB A;  5EY4 A;  1CN2 A;  3L4I A;  1OMY A;  1NGH A;  1SN4 A;  1ZYW A;  1SEG A;  2JDQ D;  3E7R L;  2D56 A;  3M3Z A;  1JKZ A;  3LDP A;  4FL9 A;  1NPI A;  1I2U A;  3FZH A;  3PSM A;  4AB0 A;  1BA0 A;  3D2F A;  2GL1 A;  5FPM A;  5AQU A;  1GPT A;  2N2R A;  5BPN A;  2QW9 A;  3GDQ A;  1HX1 A;  1NRA A;  5AQF A;  2V7Z A;  1NGB A;  3QFP A;  2KHO A;  5AQY A;  1B3C A;  4UAF E;  4KBO A;  1VNB A;  5EX5 A;  1OZZ A;  2E8A A;  2YIO A;  1KV0 A;  5AQL A;  3KOZ A;  3C7N A;  1T0Z A;  2BRZ A;  2N66 A;  3KC6 A;  1NGG A;  4HHF A;  1HPM A;  1NGC A;  1KAZ A;  2MZ0 A;  5BPL A;  2MN5 A;  3FE1 A;  5FPN A;  5AQN A;  2KBJ A;  1ICA A;  1SNB A;  3L6Q A;  5FPD A;  3KHW A;  1QQM A;  3QI7 A;  4H5R A;  1NRB A;  3BK3 C;  1BMR A;  4IO8 A;  2KGQ A;  3GL1 A;  2LR3 A;  5AQT A;  1JZB A;  1NE5 A;  2LN8 A;  2B3C A;  3KP0 A;  2YIL A;  4AAZ A;  3IUC A;  2YBR C;  1ATS A;  1S3X A;  5AQG A;  3KOY A;  1T7A A;  3HSC A;  3JXU A;  4H5N A;  4HE7 A;  1JZA A;  3QML A;  1LQH A;  1T1T A;  5AQW A;  1ZVG A;  4UAD E;  1LQQ A;  1P00 A;  1T7B A;  2QXL A;  2YC1 C;  1TI5 A;  2A7T A;  1NGE A;  3LDN A;  3FZM A;  4FSV A;  1PTX A;  1MR4 A;  1NGA A;  2ATB A;  1DJT A;  3FZK A;  3D2E A;  5CY0 A;  1HJO A;  1BRZ A;  1VNA A;  1BCG A;  1T7E A;  1WT7 A;  1AHO A;  3FZF A;  1NGJ A;  2ASC A;  1B7D A;  2SN3 A;  1NGD A;  1QQN A;  3LDL A;  5BN9 A;  3D2F B;  1ZYV A;  1K8B A;  5AQO A;  2LI7 A;  2KSK A;  1ZVE A;  5KK4 A;  2MBK A;  5AQS A;  2KPY A;  2LJ7 A;  2QWL A;  1I6F A;  1SN1 A;  1I6G A;  3ATV A;  4GNI A;  1C55 A;  3KOX A;  2KYQ A;  1C56 A;  5AQK A;  4H5T A;  2E88 A;  1AYJ A;  1NGF A;  4UJ0 A;  5AQZ A;  2N2Q A;  2E0H A;  2GMO A;  2LJM A;  1YUW A;  2KJA A;  3C7N B;  5AQR A;  5AQJ A;  1FH3 A;  1N4N A;  1ATR A;  1P0A A;  1I2V A;  1BA1 A;  5EXW A;  1BUP A;  1ZFU A;  3L56 A;  2YEO A;  3A8Y A;  5AQV A;  1PX9 A;  5AQH A;  5EVZ A;  2LT8 A;  2E2F A;  1LQI A;  3CQX A; 
#chains in the Genus database with same CATH homology
 5F2R A;  3R2V A;  1KAY A;  2QWQ A;  3FZL A;  2QWM A;  2QWP A;  2QWO A;  1KAX A;  2VY6 A;  5FPE A;  5F1X A;  5F0X A;  5AQI A;  5AQM A;  3LDO A;  2BUP A;  3SF4 D;  2QWN A;  2QWR A;  5BPM A;  4H5V A;  2YIP A;  3QFU A;  5AR0 A;  5AQQ A;  2K35 A;  3KVG A;  1NGI A;  3AY9 A;  3I33 A;  3D2E B;  1POI A;  5AQP A;  1DKG D;  3ATU A;  3LDQ A;  5BN8 A;  2E2F A;  4UAE F;  4HWI A;  1QQO A;  3CW4 A;  4H5W A;  5AQX A;  5EY4 A;  3L4I A;  3M3Z A;  1NGH A;  2JDQ D;  2D56 A;  3LDP A;  4FL9 A;  3FZH A;  1BA0 A;  3D2F A;  5FPM A;  5AQU A;  5BPN A;  2QW9 A;  3GDQ A;  1HX1 A;  5AQF A;  2V7Z A;  1NGB A;  3QFP A;  2KHO A;  5AQY A;  4UAF E;  4KBO A;  5EX5 A;  2E8A A;  2YIO A;  5AQL A;  3C7N A;  3KC6 A;  1NGG A;  1HPM A;  1NGC A;  1KAZ A;  5BPL A;  2MN5 A;  3FE1 A;  5FPN A;  5AQN A;  3L6Q A;  5FPD A;  3KHW A;  1QQM A;  3QI7 A;  4H5R A;  3BK3 C;  4IO8 A;  3GL1 A;  5AQT A;  2LN8 A;  2YIL A;  3IUC A;  1ATS A;  1S3X A;  5AQG A;  3HSC A;  3JXU A;  4H5N A;  5AQW A;  3QML A;  4UAD E;  2QXL A;  1NGE A;  3LDN A;  3FZM A;  4FSV A;  1NGA A;  3FZK A;  3D2E A;  1HJO A;  3FZF A;  1NGJ A;  1NGD A;  1QQN A;  3LDL A;  5BN9 A;  3D2F B;  5AQO A;  2MBK A;  5AQS A;  2QWL A;  3ATV A;  4GNI A;  5AQK A;  4H5T A;  2E88 A;  1NGF A;  5AQZ A;  2GMO A;  3C7N B;  5AQR A;  1YUW A;  5AQJ A;  1ATR A;  1BA1 A;  5EXW A;  1BUP A;  3L56 A;  5AQV A;  5AQH A;  5EVZ A;  3A8Y A;  3CQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...