1T7EA

Crystal structure of mutant pro9ser of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
NSVRDAYIAKSHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-like neurotoxin BmK-I
publication title Structural Mechanism Governing Cis and Trans Isomeric States and an Intramolecular Switch for Cis/Trans Isomerization of a Non-proline Peptide Bond Observed in Crystal Structures of Scorpion Toxins
pubmed doi rcsb
source organism Mesobuthus martensii
molecule tags Toxin
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1t7eA00
4KYPA 2LY5A 2B68A 1T7BA 2E3FA 1I6GA 1NH5A 4AB0A 1KV0A 1ZFUA 1TI5A 2ASCA 1ZYVA 2KBJA 3E7RL 2LT8A 4CQKA 1CHZA 1VNBA 2NY9X 1BRZA 2KBKA 1SNBA 1ZVEA 1WT7A 2LJ7A 1FH3A 1NPIA 1P0AA 1GPSA 1PE4A 1JZAA 1ZYWA 2KGQA 2I61A 3PSMA 2GL1A 2M8BB 1MYNA 2LR3A 1JZBA 1DQ7A 4HHFA 1MR4A 1SN4A 2KBHA 1NE5A 1P00A 2LJMA 2KPYA 2BRZA 5CY0A 1AHOA 1SEGA 2N69A 1I6FA 2LI7A 3E7UX 1BCGA 1SN1A 1T1TA 2YEOA 2LKBA 2YBRC 4V1DC 1B3CA 1T7EA 1NRBA 2KYQA 2YC1C 1OZZA 2E3GA 2N2QA 1BMRA 1C56A 2N66A 2A7TA 1NRAA 1BK8A 2KJAA 5KK4A 1B7DA 4AEIA 1ICAA 2E0HA 1WWNA 2KSKA 1I2VA 1ZVGA 1ZU3A 2ATBA 1PX9A 1GPTA 1LQHA 4AAZA 1VNAA 2B3CA 1JKZA 1N4NA 1PTXA 1ZUTA 2N2RA 1LQQA 2NY8X 1WMTA 4HE7A 1OMYA 2SN3A 1CN2A 1L4VA 1I2UA 1LQIA 2LY6A 2MZ0A 1C55A 1JXCA 1DJTA 4UJ0A 1AYJA 1T7AA 1T0ZA
chains in the Genus database with same CATH superfamily
4H5WA 4KYPA 2LY5A 2B68A 2G2KA 1T7BA 3D2EB 2E3FA 5FPMA 3IUCA 1I6GA 1NH5A 2K35A 1KV0A 2YIPA 4AB0A 1ZFUA 5AQFA 4FL9A 2JDQD 3GDQA 2QWOA 1TI5A 2ASCA 1BUPA 1ZYVA 5AQOA 1AYJA 2KBJA 5AQIA 3E7RL 1NGCA 2LT8A 1S3XA 1CHZA 2QWMA 5AQPA 1VNBA 2NY9X 3BK3C 5AQUA 4CQKA 1BRZA 3ATUA 2KBKA 5AQGA 1SNBA 1NGEA 1QQOA 2QWPA 2QW9A 1ZVEA 1WT7A 4GNIA 4H5NA 1NGAA 2LJ7A 4IO8A 5AQRA 1FH3A 1NPIA 1P0AA 1GPSA 2QXLA 2MN5A 3D2EA 1PE4A 3JXUA 4UAFE 4FSVA 2QWLA 3KC6A 3SF4D 3KHWA 3D2FB 3LDPA 5AQQA 1JZAA 1ZYWA 3CQXA 2KGQA 1QQNA 2I61A 3L6QA 3PSMA 4HWIA 2GL1A 4UADE 5FPNA 1KAXA 2M8BB 5AQKA 3FZLA 3GL1A 1MYNA 2LR3A 5AQWA 5EVZA 1K8BA 1JZBA 3I33A 5BPLA 1DQ7A 4HHFA 5AQSA 1MR4A 3M3ZA 1SN4A 2KBHA 5AQXA 5AR0A 1NE5A 5BN8A 5F0XA 2QWNA 1P00A 2LJMA 2MBKA 2E88A 2KPYA 3GKUA 3KOYA 2BRZA 5CY0A 1AHOA 1SEGA 5AQLA 3KP0A 2N69A 3LDNA 5AQNA 3D2FA 3QMLA 5F1XA 1I6FA 2LI7A 3E7UX 3KOWA 3FZHA 2QWQA 3LDQA 3QI7A 4KBOA 5BN9A 3QFPA 1BCGA 1SN1A 1T1TA 2YEOA 2LKBA 2YBRC 3KVGA 4V1DC 1B3CA 5AQMA 1NGGA 1NRBA 1T7EA 2VY6A 2KYQA 1NGFA 2YC1C 1OZZA 1HX1A 1HPMA 2E3GA 2N2QA 1BMRA 1C56A 2N66A 2YILA 1UGLA 3LDLA 2A7TA 3FZMA 1NRAA 5AQZA 3QFUA 3FZKA 1BK8A 3FZFA 3CW4A 1ATSA 2KJAA 2BUPA 5KK4A 1B7DA 1QQMA 2E8AA 4AEIA 1ICAA 3C7NB 2E0HA 3A8YA 5FPEA 1WWNA 2KSKA 4H5TA 5AQVA 1NGBA 1ZU3A 1ZVGA 1I2VA 2ATBA 1PX9A 5AQYA 1LQHA 5EY4A 5BPNA 3HSCA 1GPTA 4AAZA 1VNAA 5FPDA 1NGHA 2B3CA 3KOXA 5F2RA 1JKZA 1HJOA 1BA1A 1KAYA 4H5VA 1N4NA 1PTXA 1ZUTA 2N2RA 1LQQA 3R2VA 5AQJA 3FE1A 1NGIA 2NY8X 1NGDA 4H5RA 1WMTA 2D56A 3KP1A 2GMOA 1OMYA 1DKGD 2LN8A 2SN3A 2V7ZA 4HE7A 5EX5A 5EXWA 1ATRA 1CN2A 2QWRA 1KAZA 5AQTA 3LDOA 1L4VA 1I2UA 3C7NA 5AQHA 1LQIA 2LY6A 5BPMA 3L4IA 1XRSB 1NGJA 1POIA 2KHOA 2MZ0A 3AY9A 1C55A 3L56A 1YUWA 2YIOA 3ATVA 1BA0A 1DJTA 1JXCA 2E2FA 4UJ0A 3KOZA 4UAEF 1T7AA 1T0ZA
chains in the Genus database with same CATH topology
4KYPA 2LY5A 2B68A 1T7BA 2E3FA 1I6GA 1NH5A 4AB0A 1KV0A 1ZFUA 1TI5A 2ASCA 1ZYVA 2KBJA 3E7RL 2LT8A 4CQKA 1CHZA 1VNBA 2NY9X 1BRZA 2KBKA 1SNBA 1ZVEA 1WT7A 2LJ7A 1FH3A 1NPIA 1P0AA 1GPSA 1PE4A 1JZAA 1ZYWA 2KGQA 2I61A 3PSMA 2GL1A 2M8BB 1MYNA 2LR3A 1JZBA 1DQ7A 4HHFA 1MR4A 1SN4A 2KBHA 1NE5A 1P00A 2LJMA 2KPYA 2BRZA 5CY0A 1AHOA 1SEGA 2N69A 1I6FA 2LI7A 3E7UX 1BCGA 1SN1A 1T1TA 2YEOA 2LKBA 2YBRC 4V1DC 1B3CA 1T7EA 1NRBA 2KYQA 2YC1C 1OZZA 2E3GA 2N2QA 1BMRA 1C56A 2N66A 2A7TA 1NRAA 1BK8A 2KJAA 5KK4A 1B7DA 4AEIA 1ICAA 2E0HA 1WWNA 2KSKA 1I2VA 1ZVGA 1ZU3A 2ATBA 1PX9A 1GPTA 1LQHA 4AAZA 1VNAA 2B3CA 1JKZA 1N4NA 1PTXA 1ZUTA 2N2RA 1LQQA 2NY8X 1WMTA 4HE7A 1OMYA 2SN3A 1CN2A 1L4VA 1I2UA 1LQIA 2LY6A 2MZ0A 1C55A 1JXCA 1DJTA 4UJ0A 1AYJA 1T7AA 1T0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYP A;  2LY5 A;  2B68 A;  1T7B A;  2E3F A;  1I6G A;  1NH5 A;  4AB0 A;  1KV0 A;  1ZFU A;  1TI5 A;  2ASC A;  1ZYV A;  2KBJ A;  3E7R L;  2LT8 A;  4CQK A;  1CHZ A;  1VNB A;  2NY9 X;  1BRZ A;  2KBK A;  1SNB A;  1ZVE A;  1WT7 A;  2LJ7 A;  1FH3 A;  1NPI A;  1P0A A;  1GPS A;  1PE4 A;  1JZA A;  1ZYW A;  2KGQ A;  2I61 A;  3PSM A;  2GL1 A;  2M8B B;  1MYN A;  2LR3 A;  1JZB A;  1DQ7 A;  4HHF A;  1MR4 A;  1SN4 A;  2KBH A;  1NE5 A;  1P00 A;  2LJM A;  2KPY A;  2BRZ A;  5CY0 A;  1AHO A;  1SEG A;  2N69 A;  1I6F A;  2LI7 A;  3E7U X;  1BCG A;  1SN1 A;  1T1T A;  2YEO A;  2LKB A;  2YBR C;  4V1D C;  1B3C A;  1T7E A;  1NRB A;  2KYQ A;  2YC1 C;  1OZZ A;  2E3G A;  2N2Q A;  1BMR A;  1C56 A;  2N66 A;  2A7T A;  1NRA A;  1BK8 A;  2KJA A;  5KK4 A;  1B7D A;  4AEI A;  1ICA A;  2E0H A;  1WWN A;  2KSK A;  1I2V A;  1ZVG A;  1ZU3 A;  2ATB A;  1PX9 A;  1GPT A;  1LQH A;  4AAZ A;  1VNA A;  2B3C A;  1JKZ A;  1N4N A;  1PTX A;  1ZUT A;  2N2R A;  1LQQ A;  2NY8 X;  1WMT A;  4HE7 A;  1OMY A;  2SN3 A;  1CN2 A;  1L4V A;  1I2U A;  1LQI A;  2LY6 A;  2MZ0 A;  1C55 A;  1JXC A;  1DJT A;  4UJ0 A;  1AYJ A;  1T7A A;  1T0Z A; 
#chains in the Genus database with same CATH topology
 4H5W A;  4KYP A;  2LY5 A;  2B68 A;  2G2K A;  1T7B A;  3D2E B;  2E3F A;  5FPM A;  3IUC A;  1I6G A;  1NH5 A;  2K35 A;  1KV0 A;  2YIP A;  4AB0 A;  1ZFU A;  5AQF A;  4FL9 A;  2JDQ D;  3GDQ A;  2QWO A;  1TI5 A;  2ASC A;  1BUP A;  1ZYV A;  5AQO A;  1AYJ A;  2KBJ A;  5AQI A;  3E7R L;  1NGC A;  2LT8 A;  1S3X A;  1CHZ A;  2QWM A;  5AQP A;  1VNB A;  2NY9 X;  3BK3 C;  5AQU A;  4CQK A;  1BRZ A;  3ATU A;  2KBK A;  5AQG A;  1SNB A;  1NGE A;  1QQO A;  2QWP A;  2QW9 A;  1ZVE A;  1WT7 A;  4GNI A;  4H5N A;  1NGA A;  2LJ7 A;  4IO8 A;  5AQR A;  1FH3 A;  1NPI A;  1P0A A;  1GPS A;  2QXL A;  2MN5 A;  3D2E A;  1PE4 A;  3JXU A;  4UAF E;  4FSV A;  2QWL A;  3KC6 A;  3SF4 D;  3KHW A;  3D2F B;  3LDP A;  5AQQ A;  1JZA A;  1ZYW A;  3CQX A;  2KGQ A;  1QQN A;  2I61 A;  3L6Q A;  3PSM A;  4HWI A;  2GL1 A;  4UAD E;  5FPN A;  1KAX A;  2M8B B;  5AQK A;  3FZL A;  3GL1 A;  1MYN A;  2LR3 A;  5AQW A;  5EVZ A;  1K8B A;  1JZB A;  3I33 A;  5BPL A;  1DQ7 A;  4HHF A;  5AQS A;  1MR4 A;  3M3Z A;  1SN4 A;  2KBH A;  5AQX A;  5AR0 A;  1NE5 A;  5BN8 A;  5F0X A;  2QWN A;  1P00 A;  2LJM A;  2MBK A;  2E88 A;  2KPY A;  3GKU A;  3KOY A;  2BRZ A;  5CY0 A;  1AHO A;  1SEG A;  5AQL A;  3KP0 A;  2N69 A;  3LDN A;  5AQN A;  3D2F A;  3QML A;  5F1X A;  1I6F A;  2LI7 A;  3E7U X;  3KOW A;  3FZH A;  2QWQ A;  3LDQ A;  3QI7 A;  4KBO A;  5BN9 A;  3QFP A;  1BCG A;  1SN1 A;  1T1T A;  2YEO A;  2LKB A;  2YBR C;  3KVG A;  4V1D C;  1B3C A;  5AQM A;  1NGG A;  1NRB A;  1T7E A;  2VY6 A;  2KYQ A;  1NGF A;  2YC1 C;  1OZZ A;  1HX1 A;  1HPM A;  2E3G A;  2N2Q A;  1BMR A;  1C56 A;  2N66 A;  2YIL A;  1UGL A;  3LDL A;  2A7T A;  3FZM A;  1NRA A;  5AQZ A;  3QFU A;  3FZK A;  1BK8 A;  3FZF A;  3CW4 A;  1ATS A;  2KJA A;  2BUP A;  5KK4 A;  1B7D A;  1QQM A;  2E8A A;  4AEI A;  1ICA A;  3C7N B;  2E0H A;  3A8Y A;  5FPE A;  1WWN A;  2KSK A;  4H5T A;  5AQV A;  1NGB A;  1ZU3 A;  1ZVG A;  1I2V A;  2ATB A;  1PX9 A;  5AQY A;  1LQH A;  5EY4 A;  5BPN A;  3HSC A;  1GPT A;  4AAZ A;  1VNA A;  5FPD A;  1NGH A;  2B3C A;  3KOX A;  5F2R A;  1JKZ A;  1HJO A;  1BA1 A;  1KAY A;  4H5V A;  1N4N A;  1PTX A;  1ZUT A;  2N2R A;  1LQQ A;  3R2V A;  5AQJ A;  3FE1 A;  1NGI A;  2NY8 X;  1NGD A;  4H5R A;  1WMT A;  2D56 A;  3KP1 A;  2GMO A;  1OMY A;  1DKG D;  2LN8 A;  2SN3 A;  2V7Z A;  4HE7 A;  5EX5 A;  5EXW A;  1ATR A;  1CN2 A;  2QWR A;  1KAZ A;  5AQT A;  3LDO A;  1L4V A;  1I2U A;  3C7N A;  5AQH A;  1LQI A;  2LY6 A;  5BPM A;  3L4I A;  1XRS B;  1NGJ A;  1POI A;  2KHO A;  2MZ0 A;  3AY9 A;  1C55 A;  3L56 A;  1YUW A;  2YIO A;  3ATV A;  1BA0 A;  1DJT A;  1JXC A;  2E2F A;  4UJ0 A;  3KOZ A;  4UAE F;  1T7A A;  1T0Z A; 
#chains in the Genus database with same CATH homology
 4KYP A;  2LY5 A;  2B68 A;  1T7B A;  2E3F A;  1I6G A;  1NH5 A;  4AB0 A;  1KV0 A;  1ZFU A;  1TI5 A;  2ASC A;  1ZYV A;  2KBJ A;  3E7R L;  2LT8 A;  4CQK A;  1CHZ A;  1VNB A;  2NY9 X;  1BRZ A;  2KBK A;  1SNB A;  1ZVE A;  1WT7 A;  2LJ7 A;  1FH3 A;  1NPI A;  1P0A A;  1GPS A;  1PE4 A;  1JZA A;  1ZYW A;  2KGQ A;  2I61 A;  3PSM A;  2GL1 A;  2M8B B;  1MYN A;  2LR3 A;  1JZB A;  1DQ7 A;  4HHF A;  1MR4 A;  1SN4 A;  2KBH A;  1NE5 A;  1P00 A;  2LJM A;  2KPY A;  2BRZ A;  5CY0 A;  1AHO A;  1SEG A;  2N69 A;  1I6F A;  2LI7 A;  3E7U X;  1BCG A;  1SN1 A;  1T1T A;  2YEO A;  2LKB A;  2YBR C;  4V1D C;  1B3C A;  1T7E A;  1NRB A;  2KYQ A;  2YC1 C;  1OZZ A;  2E3G A;  2N2Q A;  1BMR A;  1C56 A;  2N66 A;  2A7T A;  1NRA A;  1BK8 A;  2KJA A;  5KK4 A;  1B7D A;  4AEI A;  1ICA A;  2E0H A;  1WWN A;  2KSK A;  1I2V A;  1ZVG A;  1ZU3 A;  2ATB A;  1PX9 A;  1GPT A;  1LQH A;  4AAZ A;  1VNA A;  2B3C A;  1JKZ A;  1N4N A;  1PTX A;  1ZUT A;  2N2R A;  1LQQ A;  2NY8 X;  1WMT A;  4HE7 A;  1OMY A;  2SN3 A;  1CN2 A;  1L4V A;  1I2U A;  1LQI A;  2LY6 A;  2MZ0 A;  1C55 A;  1JXC A;  1DJT A;  4UJ0 A;  1AYJ A;  1T7A A;  1T0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...