1T7EA

Crystal structure of mutant pro9ser of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
NSVRDAYIAKSHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Alpha-like neurotoxin BmK-I
publication title Structural Mechanism Governing Cis and Trans Isomeric States and an Intramolecular Switch for Cis/Trans Isomerization of a Non-proline Peptide Bond Observed in Crystal Structures of Scorpion Toxins
pubmed doi rcsb
source organism Mesobuthus martensii
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1t7eA00
2E3GA 1LQQA 1LQHA 1BCGA 1NE5A 4UJ0A 2KBKA 1NRAA 1ZYVA 2LI7A 1GPTA 1ZYWA 2NY8X 4KYPA 1PE4A 1FH3A 1MYNA 1VNAA 1SEGA 1BMRA 4AB0A 1JZAA 2KGQA 1OZZA 2MZ0A 1AYJA 1DQ7A 1TI5A 2KBJA 2E0HA 2N66A 1OMYA 1NRBA 4CQKA 3PSMA 1JZBA 2M8BB 2N2QA 1SN1A 1T7AA 2KYQA 1C55A 2B3CA 2ATBA 2SN3A 1CHZA 5CY0A 2NY9X 2KSKA 2KJAA 2KPYA 1WMTA 1I2UA 1L4VA 1SNBA 5KK4A 2YBRC 1I6FA 2BRZA 1WWNA 1DJTA 2GL1A 1CN2A 4AAZA 1ZU3A 2LT8A 1VNBA 1BRZA 2N2RA 2E3FA 1AHOA 1MR4A 1WT7A 2LR3A 2LJ7A 2LY5A 2N69A 1I2VA 4HHFA 1P00A 4AEIA 1N4NA 2A7TA 1ZFUA 1ZUTA 1JKZA 2KBHA 1T1TA 2I61A 2LKBA 1P0AA 1LQIA 2YC1C 1SN4A 3E7RL 4V1DC 1ZVGA 3E7UX 1JXCA 4HE7A 2B68A 1C56A 2LJMA 1PX9A 1B7DA 1T7BA 1I6GA 1GPSA 1BK8A 1NH5A 1ICAA 1T0ZA 1PTXA 2ASCA 1KV0A 1NPIA 1ZVEA 2YEOA 1B3CA 1T7EA 2LY6A
chains in the Genus database with same CATH superfamily
2E8AA 2E3GA 3KOWA 1LQQA 3D2EA 4UAEF 5EY4A 5AQOA 2QWOA 1LQHA 1BCGA 1NE5A 3ATUA 3GKUA 4UJ0A 2KBKA 1ATSA 5FPNA 4H5WA 2QWQA 5AQZA 3AY9A 5AQYA 5FPDA 1NRAA 1ZYVA 2LI7A 1GPTA 1NGJA 1ZYWA 1BA1A 2NY8X 4KYPA 1PE4A 3GDQA 5AQWA 2V7ZA 1FH3A 1MYNA 1DKGD 5AQNA 3KP0A 3CW4A 1VNAA 3LDPA 5F1XA 2QWRA 1NGGA 1ATRA 1SEGA 1BMRA 4AB0A 1JZAA 2KGQA 1NGEA 5AQMA 3KOZA 1OZZA 2MZ0A 3QFPA 1DQ7A 1AYJA 5BPMA 1TI5A 2KBJA 5BN9A 1NGDA 2E0HA 5AQFA 2N66A 1OMYA 3FZMA 5AQQA 5AQHA 1NRBA 2D56A 5AQIA 4CQKA 1BRZA 2LN8A 3PSMA 5AQGA 1JZBA 3D2EB 3QFUA 3C7NA 2M8BB 2N2QA 3CQXA 2QW9A 1KAYA 3QI7A 3R2VA 2BUPA 1SN1A 1T7AA 2KYQA 5EXWA 2B3CA 1C55A 2ATBA 2SN3A 1NGHA 5AQXA 4GNIA 1NGAA 2JDQD 1CHZA 5CY0A 3KP1A 2NY9X 2KSKA 2KJAA 3FZHA 1UGLA 2KPYA 5EVZA 1WMTA 4HWIA 1I2UA 2QWMA 5AQJA 1L4VA 1SNBA 5KK4A 2YBRC 1I6FA 3FZKA 2BRZA 1NGCA 2YILA 3D2FA 1HX1A 3KC6A 1WWNA 1DJTA 3L6QA 4UADE 1NGIA 5F0XA 4FSVA 2GL1A 1CN2A 1YUWA 4AAZA 1ZU3A 1S3XA 1VNBA 2LT8A 3BK3C 1KAXA 4IO8A 2N2RA 3LDNA 2YIOA 3C7NB 1QQMA 2E3FA 1AHOA 3LDOA 1MR4A 1WT7A 2LR3A 3KHWA 4KBOA 2LJ7A 2LY5A 2K35A 2N69A 5FPMA 5AQTA 3I33A 1I2VA 5EX5A 1NGFA 5FPEA 5AQRA 2VY6A 4HHFA 3SF4D 1NGBA 1P00A 4AEIA 1N4NA 2A7TA 5AQUA 5BPNA 3M3ZA 1POIA 1ZFUA 4H5VA 1ZUTA 5AR0A 1JKZA 2KBHA 1T1TA 1KAZA 2I61A 2LKBA 3QMLA 5AQSA 3JXUA 1P0AA 4H5NA 1LQIA 2GMOA 1HJOA 2QWPA 3FZLA 4UAFE 3HSCA 3D2FB 5AQVA 2YC1C 3L4IA 5F2RA 1SN4A 2QXLA 2E2FA 2G2KA 3ATVA 2MBKA 3E7RL 3KVGA 3LDLA 4FL9A 4H5TA 5AQKA 1ZVGA 3E7UX 1JXCA 4HE7A 2B68A 1C56A 2LJMA 3FZFA 1BA0A 1B7DA 1PX9A 1T7BA 3L56A 5BN8A 2QWNA 3LDQA 3KOXA 1GPSA 1I6GA 1BK8A 2E88A 1NH5A 1ICAA 3IUCA 1BUPA 1QQNA 1T0ZA 1QQOA 3KOYA 1PTXA 2QWLA 3FE1A 5AQLA 3A8YA 5AQPA 2ASCA 1XRSB 4V1DC 5BPLA 2MN5A 2KHOA 2YIPA 3GL1A 1KV0A 1NPIA 1ZVEA 2YEOA 4H5RA 1K8BA 1B3CA 1T7EA 1HPMA 2LY6A
chains in the Genus database with same CATH topology
2E3GA 1LQQA 1LQHA 1BCGA 1NE5A 4UJ0A 2KBKA 1NRAA 1ZYVA 2LI7A 1GPTA 1ZYWA 2NY8X 4KYPA 1PE4A 1FH3A 1MYNA 1VNAA 1SEGA 1BMRA 4AB0A 1JZAA 2KGQA 1OZZA 2MZ0A 1AYJA 1DQ7A 1TI5A 2KBJA 2E0HA 2N66A 1OMYA 1NRBA 4CQKA 3PSMA 1JZBA 2M8BB 2N2QA 1SN1A 1T7AA 2KYQA 1C55A 2B3CA 2ATBA 2SN3A 1CHZA 5CY0A 2NY9X 2KSKA 2KJAA 2KPYA 1WMTA 1I2UA 1L4VA 1SNBA 5KK4A 2YBRC 1I6FA 2BRZA 1WWNA 1DJTA 2GL1A 1CN2A 4AAZA 1ZU3A 2LT8A 1VNBA 1BRZA 2N2RA 2E3FA 1AHOA 1MR4A 1WT7A 2LR3A 2LJ7A 2LY5A 2N69A 1I2VA 4HHFA 1P00A 4AEIA 1N4NA 2A7TA 1ZFUA 1ZUTA 1JKZA 2KBHA 1T1TA 2I61A 2LKBA 1P0AA 1LQIA 2YC1C 1SN4A 3E7RL 4V1DC 1ZVGA 3E7UX 1JXCA 4HE7A 2B68A 1C56A 2LJMA 1PX9A 1B7DA 1T7BA 1I6GA 1GPSA 1BK8A 1NH5A 1ICAA 1T0ZA 1PTXA 2ASCA 1KV0A 1NPIA 1ZVEA 2YEOA 1B3CA 1T7EA 2LY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3G A;  1LQQ A;  1LQH A;  1BCG A;  1NE5 A;  4UJ0 A;  2KBK A;  1NRA A;  1ZYV A;  2LI7 A;  1GPT A;  1ZYW A;  2NY8 X;  4KYP A;  1PE4 A;  1FH3 A;  1MYN A;  1VNA A;  1SEG A;  1BMR A;  4AB0 A;  1JZA A;  2KGQ A;  1OZZ A;  2MZ0 A;  1AYJ A;  1DQ7 A;  1TI5 A;  2KBJ A;  2E0H A;  2N66 A;  1OMY A;  1NRB A;  4CQK A;  3PSM A;  1JZB A;  2M8B B;  2N2Q A;  1SN1 A;  1T7A A;  2KYQ A;  1C55 A;  2B3C A;  2ATB A;  2SN3 A;  1CHZ A;  5CY0 A;  2NY9 X;  2KSK A;  2KJA A;  2KPY A;  1WMT A;  1I2U A;  1L4V A;  1SNB A;  5KK4 A;  2YBR C;  1I6F A;  2BRZ A;  1WWN A;  1DJT A;  2GL1 A;  1CN2 A;  4AAZ A;  1ZU3 A;  2LT8 A;  1VNB A;  1BRZ A;  2N2R A;  2E3F A;  1AHO A;  1MR4 A;  1WT7 A;  2LR3 A;  2LJ7 A;  2LY5 A;  2N69 A;  1I2V A;  4HHF A;  1P00 A;  4AEI A;  1N4N A;  2A7T A;  1ZFU A;  1ZUT A;  1JKZ A;  2KBH A;  1T1T A;  2I61 A;  2LKB A;  1P0A A;  1LQI A;  2YC1 C;  1SN4 A;  3E7R L;  4V1D C;  1ZVG A;  3E7U X;  1JXC A;  4HE7 A;  2B68 A;  1C56 A;  2LJM A;  1PX9 A;  1B7D A;  1T7B A;  1I6G A;  1GPS A;  1BK8 A;  1NH5 A;  1ICA A;  1T0Z A;  1PTX A;  2ASC A;  1KV0 A;  1NPI A;  1ZVE A;  2YEO A;  1B3C A;  1T7E A;  2LY6 A; 
#chains in the Genus database with same CATH topology
 2E8A A;  2E3G A;  3KOW A;  1LQQ A;  3D2E A;  4UAE F;  5EY4 A;  5AQO A;  2QWO A;  1LQH A;  1BCG A;  1NE5 A;  3ATU A;  3GKU A;  4UJ0 A;  2KBK A;  1ATS A;  5FPN A;  4H5W A;  2QWQ A;  5AQZ A;  3AY9 A;  5AQY A;  5FPD A;  1NRA A;  1ZYV A;  2LI7 A;  1GPT A;  1NGJ A;  1ZYW A;  1BA1 A;  2NY8 X;  4KYP A;  1PE4 A;  3GDQ A;  5AQW A;  2V7Z A;  1FH3 A;  1MYN A;  1DKG D;  5AQN A;  3KP0 A;  3CW4 A;  1VNA A;  3LDP A;  5F1X A;  2QWR A;  1NGG A;  1ATR A;  1SEG A;  1BMR A;  4AB0 A;  1JZA A;  2KGQ A;  1NGE A;  5AQM A;  3KOZ A;  1OZZ A;  2MZ0 A;  3QFP A;  1DQ7 A;  1AYJ A;  5BPM A;  1TI5 A;  2KBJ A;  5BN9 A;  1NGD A;  2E0H A;  5AQF A;  2N66 A;  1OMY A;  3FZM A;  5AQQ A;  5AQH A;  1NRB A;  2D56 A;  5AQI A;  4CQK A;  1BRZ A;  2LN8 A;  3PSM A;  5AQG A;  1JZB A;  3D2E B;  3QFU A;  3C7N A;  2M8B B;  2N2Q A;  3CQX A;  2QW9 A;  1KAY A;  3QI7 A;  3R2V A;  2BUP A;  1SN1 A;  1T7A A;  2KYQ A;  5EXW A;  2B3C A;  1C55 A;  2ATB A;  2SN3 A;  1NGH A;  5AQX A;  4GNI A;  1NGA A;  2JDQ D;  1CHZ A;  5CY0 A;  3KP1 A;  2NY9 X;  2KSK A;  2KJA A;  3FZH A;  1UGL A;  2KPY A;  5EVZ A;  1WMT A;  4HWI A;  1I2U A;  2QWM A;  5AQJ A;  1L4V A;  1SNB A;  5KK4 A;  2YBR C;  1I6F A;  3FZK A;  2BRZ A;  1NGC A;  2YIL A;  3D2F A;  1HX1 A;  3KC6 A;  1WWN A;  1DJT A;  3L6Q A;  4UAD E;  1NGI A;  5F0X A;  4FSV A;  2GL1 A;  1CN2 A;  1YUW A;  4AAZ A;  1ZU3 A;  1S3X A;  1VNB A;  2LT8 A;  3BK3 C;  1KAX A;  4IO8 A;  2N2R A;  3LDN A;  2YIO A;  3C7N B;  1QQM A;  2E3F A;  1AHO A;  3LDO A;  1MR4 A;  1WT7 A;  2LR3 A;  3KHW A;  4KBO A;  2LJ7 A;  2LY5 A;  2K35 A;  2N69 A;  5FPM A;  5AQT A;  3I33 A;  1I2V A;  5EX5 A;  1NGF A;  5FPE A;  5AQR A;  2VY6 A;  4HHF A;  3SF4 D;  1NGB A;  1P00 A;  4AEI A;  1N4N A;  2A7T A;  5AQU A;  5BPN A;  3M3Z A;  1POI A;  1ZFU A;  4H5V A;  1ZUT A;  5AR0 A;  1JKZ A;  2KBH A;  1T1T A;  1KAZ A;  2I61 A;  2LKB A;  3QML A;  5AQS A;  3JXU A;  1P0A A;  4H5N A;  1LQI A;  2GMO A;  1HJO A;  2QWP A;  3FZL A;  4UAF E;  3HSC A;  3D2F B;  5AQV A;  2YC1 C;  3L4I A;  5F2R A;  1SN4 A;  2QXL A;  2E2F A;  2G2K A;  3ATV A;  2MBK A;  3E7R L;  3KVG A;  3LDL A;  4FL9 A;  4H5T A;  5AQK A;  1ZVG A;  3E7U X;  1JXC A;  4HE7 A;  2B68 A;  1C56 A;  2LJM A;  3FZF A;  1BA0 A;  1B7D A;  1PX9 A;  1T7B A;  3L56 A;  5BN8 A;  2QWN A;  3LDQ A;  3KOX A;  1GPS A;  1I6G A;  1BK8 A;  2E88 A;  1NH5 A;  1ICA A;  3IUC A;  1BUP A;  1QQN A;  1T0Z A;  1QQO A;  3KOY A;  1PTX A;  2QWL A;  3FE1 A;  5AQL A;  3A8Y A;  5AQP A;  2ASC A;  1XRS B;  4V1D C;  5BPL A;  2MN5 A;  2KHO A;  2YIP A;  3GL1 A;  1KV0 A;  1NPI A;  1ZVE A;  2YEO A;  4H5R A;  1K8B A;  1B3C A;  1T7E A;  1HPM A;  2LY6 A; 
#chains in the Genus database with same CATH homology
 2E3G A;  1LQQ A;  1LQH A;  1BCG A;  1NE5 A;  4UJ0 A;  2KBK A;  1NRA A;  1ZYV A;  2LI7 A;  1GPT A;  1ZYW A;  2NY8 X;  4KYP A;  1PE4 A;  1FH3 A;  1MYN A;  1VNA A;  1SEG A;  1BMR A;  4AB0 A;  1JZA A;  2KGQ A;  1OZZ A;  2MZ0 A;  1AYJ A;  1DQ7 A;  1TI5 A;  2KBJ A;  2E0H A;  2N66 A;  1OMY A;  1NRB A;  4CQK A;  3PSM A;  1JZB A;  2M8B B;  2N2Q A;  1SN1 A;  1T7A A;  2KYQ A;  1C55 A;  2B3C A;  2ATB A;  2SN3 A;  1CHZ A;  5CY0 A;  2NY9 X;  2KSK A;  2KJA A;  2KPY A;  1WMT A;  1I2U A;  1L4V A;  1SNB A;  5KK4 A;  2YBR C;  1I6F A;  2BRZ A;  1WWN A;  1DJT A;  2GL1 A;  1CN2 A;  4AAZ A;  1ZU3 A;  2LT8 A;  1VNB A;  1BRZ A;  2N2R A;  2E3F A;  1AHO A;  1MR4 A;  1WT7 A;  2LR3 A;  2LJ7 A;  2LY5 A;  2N69 A;  1I2V A;  4HHF A;  1P00 A;  4AEI A;  1N4N A;  2A7T A;  1ZFU A;  1ZUT A;  1JKZ A;  2KBH A;  1T1T A;  2I61 A;  2LKB A;  1P0A A;  1LQI A;  2YC1 C;  1SN4 A;  3E7R L;  4V1D C;  1ZVG A;  3E7U X;  1JXC A;  4HE7 A;  2B68 A;  1C56 A;  2LJM A;  1PX9 A;  1B7D A;  1T7B A;  1I6G A;  1GPS A;  1BK8 A;  1NH5 A;  1ICA A;  1T0Z A;  1PTX A;  2ASC A;  1KV0 A;  1NPI A;  1ZVE A;  2YEO A;  1B3C A;  1T7E A;  2LY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...