2KYQA

1h, 15n, 13c chemical shifts and structure of ckr-brazzein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
53
structure length
53
Chain Sequence
DCKRKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defensin-like protein
publication title Structural role of the terminal disulfide bond in the sweetness of brazzein.
pubmed doi rcsb
source organism Pentadiplandra brazzeana
molecule tags Plant protein
total genus 7
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2010-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2kyqA00
2NY9X 4AB0A 1BK8A 1SEGA 1I6FA 2KBHA 1TI5A 2LI7A 4V1DC 3PSMA 1ZYVA 1GPTA 1MYNA 2LKBA 1DJTA 1ZFUA 2N2QA 2N2RA 1I6GA 1JXCA 2YC1C 1GPSA 1L4VA 2KBJA 2B68A 1ZU3A 2KJAA 2LR3A 1P0AA 1SNBA 1CHZA 2LJMA 2MZ0A 1KV0A 1PX9A 1FH3A 1BMRA 1LQIA 1VNAA 1OZZA 2LY5A 2BRZA 1MR4A 4AEIA 1JZBA 1C55A 2SN3A 1T1TA 1C56A 2I61A 1NRAA 2ATBA 5KK4A 2N69A 1N4NA 2LT8A 2E3GA 2LJ7A 1WWNA 2KGQA 1DQ7A 1B3CA 1NE5A 1T0ZA 4CQKA 1ZYWA 1B7DA 1WMTA 2YBRC 2KBKA 1T7EA 2YEOA 1BCGA 1SN1A 2E3FA 2KPYA 1SN4A 3E7UX 1AYJA 1LQQA 3E7RL 1JKZA 4HE7A 1NRBA 1NH5A 2LY6A 1I2UA 1OMYA 1ZUTA 1JZAA 1VNBA 2GL1A 2M8BB 1PTXA 1CN2A 1LQHA 2KSKA 1P00A 2NY8X 1T7BA 2KYQA 1AHOA 1I2VA 1ZVEA 1PE4A 5CY0A 1BRZA 2A7TA 2E0HA 1T7AA 4HHFA 1NPIA 2B3CA 4KYPA 4AAZA 4UJ0A 1ICAA 2ASCA 2N66A 1ZVGA 1WT7A
chains in the Genus database with same CATH superfamily
1NGAA 2NY9X 1XRSB 4AB0A 1POIA 1NGEA 1BK8A 1SEGA 5AQHA 4H5RA 5AQSA 5BPMA 3FZKA 1I6FA 3KC6A 5AQWA 2KBHA 1TI5A 1C55A 3GL1A 5AQLA 5AQZA 2V7ZA 1QQOA 2LI7A 3PSMA 1ZYVA 4V1DC 5AQJA 1GPTA 1MYNA 3FZMA 2LKBA 5AQGA 2QWOA 2QW9A 1DJTA 1ZFUA 2N2QA 2N2RA 1I6GA 1JXCA 2G2KA 2YC1C 1GPSA 1L4VA 5EXWA 2KBJA 3FZFA 2B68A 1ZU3A 1HX1A 2E88A 2KJAA 5BN9A 2LR3A 1P0AA 3CQXA 3D2FB 1SNBA 5F1XA 2JDQD 1CHZA 3KOWA 2QWPA 2LJMA 1NGCA 1KV0A 1PX9A 2MZ0A 5FPMA 1HJOA 3D2FA 4H5NA 1FH3A 1BMRA 1LQIA 1VNAA 5BPNA 2GMOA 3M3ZA 1OZZA 3GDQA 2LY5A 2BRZA 3D2EB 3KOYA 4H5TA 1MR4A 3I33A 4AEIA 2QWMA 5AQQA 3D2EA 1JZBA 1UGLA 2SN3A 3FE1A 3L6QA 1T1TA 3KOXA 2BUPA 3QMLA 5AQPA 5F0XA 3KOZA 1C56A 2I61A 1NRAA 2ATBA 5KK4A 1NGIA 4UADE 2YILA 5AQRA 2QXLA 2N69A 1QQNA 5EY4A 5AQFA 1N4NA 3GKUA 2LN8A 3QI7A 5AR0A 3LDOA 1YUWA 5AQOA 2MN5A 3KP1A 4UAEF 1DKGD 2LT8A 2E2FA 2E3GA 2LJ7A 1WWNA 3LDPA 2KHOA 2KGQA 5AQUA 1DQ7A 3SF4D 2YIOA 1NE5A 1BA0A 1NGGA 1S3XA 1B3CA 1T0ZA 4CQKA 1KAYA 3KP0A 5AQIA 4HWIA 4H5VA 5FPNA 5FPEA 3A8YA 1ZYWA 3QFPA 1QQMA 1B7DA 2QWQA 1KAZA 1WMTA 2K35A 2YBRC 2KBKA 2YIPA 1T7EA 3AY9A 3QFUA 2YEOA 3FZLA 4IO8A 1NGDA 1BCGA 3FZHA 2QWRA 1SN1A 2E3FA 1HPMA 1ATRA 2KPYA 3CW4A 1NGFA 1SN4A 4GNIA 3L4IA 5EVZA 1ATSA 4FSVA 3E7UX 1AYJA 1LQQA 3E7RL 2QWLA 4H5WA 1KAXA 1JKZA 3JXUA 4KBOA 4HE7A 3LDQA 1NRBA 1NH5A 4UAFE 2LY6A 1I2UA 1OMYA 1ZUTA 5AQMA 1JZAA 3BK3C 3IUCA 1VNBA 2GL1A 2VY6A 2M8BB 1NGJA 1PTXA 3HSCA 1CN2A 1LQHA 2KSKA 1P00A 2NY8X 3KHWA 3LDNA 5AQKA 4FL9A 1T7BA 2E8AA 2KYQA 5EX5A 1AHOA 1I2VA 3C7NB 5FPDA 2D56A 2MBKA 1ZVEA 5AQTA 1PE4A 3KVGA 5CY0A 3C7NA 1BA1A 3L56A 1NGHA 3LDLA 1BRZA 2A7TA 1NGBA 3ATVA 5BN8A 1BUPA 1T7AA 2E0HA 5AQNA 5AQVA 3R2VA 2QWNA 1NPIA 2B3CA 4HHFA 4KYPA 5AQYA 4AAZA 4UJ0A 5BPLA 1ICAA 2ASCA 2N66A 1K8BA 5F2RA 3ATUA 1ZVGA 5AQXA 1WT7A
chains in the Genus database with same CATH topology
2NY9X 4AB0A 1BK8A 1SEGA 1I6FA 2KBHA 1TI5A 2LI7A 4V1DC 3PSMA 1ZYVA 1GPTA 1MYNA 2LKBA 1DJTA 1ZFUA 2N2QA 2N2RA 1I6GA 1JXCA 2YC1C 1GPSA 1L4VA 2KBJA 2B68A 1ZU3A 2KJAA 2LR3A 1P0AA 1SNBA 1CHZA 2LJMA 2MZ0A 1KV0A 1PX9A 1FH3A 1BMRA 1LQIA 1VNAA 1OZZA 2LY5A 2BRZA 1MR4A 4AEIA 1JZBA 1C55A 2SN3A 1T1TA 1C56A 2I61A 1NRAA 2ATBA 5KK4A 2N69A 1N4NA 2LT8A 2E3GA 2LJ7A 1WWNA 2KGQA 1DQ7A 1B3CA 1NE5A 1T0ZA 4CQKA 1ZYWA 1B7DA 1WMTA 2YBRC 2KBKA 1T7EA 2YEOA 1BCGA 1SN1A 2E3FA 2KPYA 1SN4A 3E7UX 1AYJA 1LQQA 3E7RL 1JKZA 4HE7A 1NRBA 1NH5A 2LY6A 1I2UA 1OMYA 1ZUTA 1JZAA 1VNBA 2GL1A 2M8BB 1PTXA 1CN2A 1LQHA 2KSKA 1P00A 2NY8X 1T7BA 2KYQA 1AHOA 1I2VA 1ZVEA 1PE4A 5CY0A 1BRZA 2A7TA 2E0HA 1T7AA 4HHFA 1NPIA 2B3CA 4KYPA 4AAZA 4UJ0A 1ICAA 2ASCA 2N66A 1ZVGA 1WT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NY9 X;  4AB0 A;  1BK8 A;  1SEG A;  1I6F A;  2KBH A;  1TI5 A;  2LI7 A;  4V1D C;  3PSM A;  1ZYV A;  1GPT A;  1MYN A;  2LKB A;  1DJT A;  1ZFU A;  2N2Q A;  2N2R A;  1I6G A;  1JXC A;  2YC1 C;  1GPS A;  1L4V A;  2KBJ A;  2B68 A;  1ZU3 A;  2KJA A;  2LR3 A;  1P0A A;  1SNB A;  1CHZ A;  2LJM A;  2MZ0 A;  1KV0 A;  1PX9 A;  1FH3 A;  1BMR A;  1LQI A;  1VNA A;  1OZZ A;  2LY5 A;  2BRZ A;  1MR4 A;  4AEI A;  1JZB A;  1C55 A;  2SN3 A;  1T1T A;  1C56 A;  2I61 A;  1NRA A;  2ATB A;  5KK4 A;  2N69 A;  1N4N A;  2LT8 A;  2E3G A;  2LJ7 A;  1WWN A;  2KGQ A;  1DQ7 A;  1B3C A;  1NE5 A;  1T0Z A;  4CQK A;  1ZYW A;  1B7D A;  1WMT A;  2YBR C;  2KBK A;  1T7E A;  2YEO A;  1BCG A;  1SN1 A;  2E3F A;  2KPY A;  1SN4 A;  3E7U X;  1AYJ A;  1LQQ A;  3E7R L;  1JKZ A;  4HE7 A;  1NRB A;  1NH5 A;  2LY6 A;  1I2U A;  1OMY A;  1ZUT A;  1JZA A;  1VNB A;  2GL1 A;  2M8B B;  1PTX A;  1CN2 A;  1LQH A;  2KSK A;  1P00 A;  2NY8 X;  1T7B A;  2KYQ A;  1AHO A;  1I2V A;  1ZVE A;  1PE4 A;  5CY0 A;  1BRZ A;  2A7T A;  2E0H A;  1T7A A;  4HHF A;  1NPI A;  2B3C A;  4KYP A;  4AAZ A;  4UJ0 A;  1ICA A;  2ASC A;  2N66 A;  1ZVG A;  1WT7 A; 
#chains in the Genus database with same CATH topology
 1NGA A;  2NY9 X;  1XRS B;  4AB0 A;  1POI A;  1NGE A;  1BK8 A;  1SEG A;  5AQH A;  4H5R A;  5AQS A;  5BPM A;  3FZK A;  1I6F A;  3KC6 A;  5AQW A;  2KBH A;  1TI5 A;  1C55 A;  3GL1 A;  5AQL A;  5AQZ A;  2V7Z A;  1QQO A;  2LI7 A;  3PSM A;  1ZYV A;  4V1D C;  5AQJ A;  1GPT A;  1MYN A;  3FZM A;  2LKB A;  5AQG A;  2QWO A;  2QW9 A;  1DJT A;  1ZFU A;  2N2Q A;  2N2R A;  1I6G A;  1JXC A;  2G2K A;  2YC1 C;  1GPS A;  1L4V A;  5EXW A;  2KBJ A;  3FZF A;  2B68 A;  1ZU3 A;  1HX1 A;  2E88 A;  2KJA A;  5BN9 A;  2LR3 A;  1P0A A;  3CQX A;  3D2F B;  1SNB A;  5F1X A;  2JDQ D;  1CHZ A;  3KOW A;  2QWP A;  2LJM A;  1NGC A;  1KV0 A;  1PX9 A;  2MZ0 A;  5FPM A;  1HJO A;  3D2F A;  4H5N A;  1FH3 A;  1BMR A;  1LQI A;  1VNA A;  5BPN A;  2GMO A;  3M3Z A;  1OZZ A;  3GDQ A;  2LY5 A;  2BRZ A;  3D2E B;  3KOY A;  4H5T A;  1MR4 A;  3I33 A;  4AEI A;  2QWM A;  5AQQ A;  3D2E A;  1JZB A;  1UGL A;  2SN3 A;  3FE1 A;  3L6Q A;  1T1T A;  3KOX A;  2BUP A;  3QML A;  5AQP A;  5F0X A;  3KOZ A;  1C56 A;  2I61 A;  1NRA A;  2ATB A;  5KK4 A;  1NGI A;  4UAD E;  2YIL A;  5AQR A;  2QXL A;  2N69 A;  1QQN A;  5EY4 A;  5AQF A;  1N4N A;  3GKU A;  2LN8 A;  3QI7 A;  5AR0 A;  3LDO A;  1YUW A;  5AQO A;  2MN5 A;  3KP1 A;  4UAE F;  1DKG D;  2LT8 A;  2E2F A;  2E3G A;  2LJ7 A;  1WWN A;  3LDP A;  2KHO A;  2KGQ A;  5AQU A;  1DQ7 A;  3SF4 D;  2YIO A;  1NE5 A;  1BA0 A;  1NGG A;  1S3X A;  1B3C A;  1T0Z A;  4CQK A;  1KAY A;  3KP0 A;  5AQI A;  4HWI A;  4H5V A;  5FPN A;  5FPE A;  3A8Y A;  1ZYW A;  3QFP A;  1QQM A;  1B7D A;  2QWQ A;  1KAZ A;  1WMT A;  2K35 A;  2YBR C;  2KBK A;  2YIP A;  1T7E A;  3AY9 A;  3QFU A;  2YEO A;  3FZL A;  4IO8 A;  1NGD A;  1BCG A;  3FZH A;  2QWR A;  1SN1 A;  2E3F A;  1HPM A;  1ATR A;  2KPY A;  3CW4 A;  1NGF A;  1SN4 A;  4GNI A;  3L4I A;  5EVZ A;  1ATS A;  4FSV A;  3E7U X;  1AYJ A;  1LQQ A;  3E7R L;  2QWL A;  4H5W A;  1KAX A;  1JKZ A;  3JXU A;  4KBO A;  4HE7 A;  3LDQ A;  1NRB A;  1NH5 A;  4UAF E;  2LY6 A;  1I2U A;  1OMY A;  1ZUT A;  5AQM A;  1JZA A;  3BK3 C;  3IUC A;  1VNB A;  2GL1 A;  2VY6 A;  2M8B B;  1NGJ A;  1PTX A;  3HSC A;  1CN2 A;  1LQH A;  2KSK A;  1P00 A;  2NY8 X;  3KHW A;  3LDN A;  5AQK A;  4FL9 A;  1T7B A;  2E8A A;  2KYQ A;  5EX5 A;  1AHO A;  1I2V A;  3C7N B;  5FPD A;  2D56 A;  2MBK A;  1ZVE A;  5AQT A;  1PE4 A;  3KVG A;  5CY0 A;  3C7N A;  1BA1 A;  3L56 A;  1NGH A;  3LDL A;  1BRZ A;  2A7T A;  1NGB A;  3ATV A;  5BN8 A;  1BUP A;  1T7A A;  2E0H A;  5AQN A;  5AQV A;  3R2V A;  2QWN A;  1NPI A;  2B3C A;  4HHF A;  4KYP A;  5AQY A;  4AAZ A;  4UJ0 A;  5BPL A;  1ICA A;  2ASC A;  2N66 A;  1K8B A;  5F2R A;  3ATU A;  1ZVG A;  5AQX A;  1WT7 A; 
#chains in the Genus database with same CATH homology
 2NY9 X;  4AB0 A;  1BK8 A;  1SEG A;  1I6F A;  2KBH A;  1TI5 A;  2LI7 A;  4V1D C;  3PSM A;  1ZYV A;  1GPT A;  1MYN A;  2LKB A;  1DJT A;  1ZFU A;  2N2Q A;  2N2R A;  1I6G A;  1JXC A;  2YC1 C;  1GPS A;  1L4V A;  2KBJ A;  2B68 A;  1ZU3 A;  2KJA A;  2LR3 A;  1P0A A;  1SNB A;  1CHZ A;  2LJM A;  2MZ0 A;  1KV0 A;  1PX9 A;  1FH3 A;  1BMR A;  1LQI A;  1VNA A;  1OZZ A;  2LY5 A;  2BRZ A;  1MR4 A;  4AEI A;  1JZB A;  1C55 A;  2SN3 A;  1T1T A;  1C56 A;  2I61 A;  1NRA A;  2ATB A;  5KK4 A;  2N69 A;  1N4N A;  2LT8 A;  2E3G A;  2LJ7 A;  1WWN A;  2KGQ A;  1DQ7 A;  1B3C A;  1NE5 A;  1T0Z A;  4CQK A;  1ZYW A;  1B7D A;  1WMT A;  2YBR C;  2KBK A;  1T7E A;  2YEO A;  1BCG A;  1SN1 A;  2E3F A;  2KPY A;  1SN4 A;  3E7U X;  1AYJ A;  1LQQ A;  3E7R L;  1JKZ A;  4HE7 A;  1NRB A;  1NH5 A;  2LY6 A;  1I2U A;  1OMY A;  1ZUT A;  1JZA A;  1VNB A;  2GL1 A;  2M8B B;  1PTX A;  1CN2 A;  1LQH A;  2KSK A;  1P00 A;  2NY8 X;  1T7B A;  2KYQ A;  1AHO A;  1I2V A;  1ZVE A;  1PE4 A;  5CY0 A;  1BRZ A;  2A7T A;  2E0H A;  1T7A A;  4HHF A;  1NPI A;  2B3C A;  4KYP A;  4AAZ A;  4UJ0 A;  1ICA A;  2ASC A;  2N66 A;  1ZVG A;  1WT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...