2KYQA

1h, 15n, 13c chemical shifts and structure of ckr-brazzein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
53
structure length
53
Chain Sequence
b'DCKRKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Defensin-like protein
publication title Structural role of the terminal disulfide bond in the sweetness of brazzein.
pubmed doi rcsb
source organism Pentadiplandra brazzeana
molecule tags Plant protein
total genus 7
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2010-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2kyqA00
2KBHA 2LT8A 1LQQA 1ZVGA 1CHZA 2KJAA 4AEIA 1GPSA 2N2RA 4HE7A 1VNAA 2LR3A 2N2QA 2B3CA 2NY9X 2NY8X 1ZFUA 1T7EA 2ATBA 1I6GA 1FH3A 1SN1A 1I2VA 1DQ7A 1B3CA 1T7BA 1MR4A 1VNBA 2KSKA 4V1DC 1T1TA 1P0AA 5KK4A 1PTXA 1BCGA 3E7UX 2MZ0A 2E3GA 2YBRC 1KV0A 3PSMA 1WT7A 2LY5A 1I6FA 4UJ0A 1SEGA 1N4NA 1AYJA 1SNBA 1NRBA 1BK8A 1AHOA 2N66A 1NE5A 1T0ZA 1ZUTA 2LJMA 2YEOA 1LQHA 1PE4A 1ZVEA 1CN2A 1BRZA 1NRAA 3E7RL 1GPTA 2LKBA 1OMYA 1JZAA 2GL1A 2N69A 2BRZA 1MYNA 2KPYA 2KYQA 1JXCA 2E3FA 2LI7A 4KYPA 1P00A 2E0HA 2M8BB 1LQIA 1NH5A 4AAZA 1ZU3A 1I2UA 1WMTA 1ICAA 1L4VA 2KGQA 2LJ7A 4AB0A 1OZZA 1B7DA 5CY0A 2KBJA 1ZYWA 2ASCA 1JZBA 1TI5A 1DJTA 4HHFA 1WWNA 2I61A 2YC1C 2B68A 2KBKA 1NPIA 1JKZA 1T7AA 2A7TA 1BMRA 1SN4A 1C55A 1PX9A 4CQKA 2SN3A 2LY6A 1C56A 1ZYVA
chains in the Genus database with same CATH superfamily
2KBHA 1HJOA 4IO8A 2VY6A 2LT8A 1LQQA 1K8BA 1ZVGA 1CHZA 2KJAA 4AEIA 1NGHA 1GPSA 2N2RA 3KC6A 2MN5A 3ATVA 4HE7A 1VNAA 2LR3A 2QW9A 2YIPA 3D2EA 3KP0A 5AQIA 4UAFE 5AQZA 3LDPA 5BPLA 2N2QA 2B3CA 3LDOA 5EXWA 5EX5A 4H5WA 5FPNA 1POIA 2NY9X 2E8AA 1ATSA 2NY8X 5AQKA 1ZFUA 1T7EA 3QMLA 4H5RA 2ATBA 5BN8A 1I6GA 1FH3A 2QWLA 5AQVA 3L4IA 3LDNA 3IUCA 1NGGA 1BA0A 1SN1A 1I2VA 1QQOA 3L6QA 1DQ7A 3FZLA 3KOYA 5AQOA 1B3CA 4UAEF 3KHWA 1T7BA 5EY4A 1MR4A 1VNBA 2KSKA 4H5VA 4V1DC 5EVZA 1UGLA 3GL1A 4GNIA 1NGFA 1T1TA 3I33A 3CW4A 1P0AA 1NGJA 3KOWA 3L56A 5AQGA 1PTXA 1BCGA 3E7UX 4FSVA 5AQXA 1NGDA 3C7NB 2MZ0A 5KK4A 2E3GA 4KBOA 2QWNA 2QXLA 3A8YA 3GDQA 2BUPA 2YBRC 1KV0A 1NGCA 3PSMA 2QWPA 1QQNA 5AQPA 1KAXA 1BA1A 1WT7A 2LY5A 2MBKA 3FZFA 1I6FA 4UJ0A 1SEGA 1N4NA 1AYJA 5AQHA 1NGIA 2YIOA 1SNBA 3C7NA 5FPEA 5AQYA 3QI7A 3D2FB 3CQXA 1NRBA 1XRSB 5FPMA 1BK8A 1AHOA 2N66A 2QWOA 4H5NA 4UADE 5AQFA 1NE5A 3R2VA 5AQNA 1T0ZA 1ZUTA 1KAZA 2LJMA 2LN8A 3KP1A 1ATRA 2YEOA 3AY9A 1LQHA 1PE4A 2E88A 1ZVEA 1CN2A 1BRZA 1DKGD 1NRAA 2V7ZA 3D2FA 3E7RL 1GPTA 2QWQA 1NGAA 2LKBA 3M3ZA 2KHOA 1OMYA 5AQWA 1JZAA 5AR0A 5AQRA 2D56A 2GL1A 3FZHA 1BUPA 1QQMA 2K35A 2G2KA 2N69A 2BRZA 1MYNA 2KPYA 2KYQA 3LDLA 5FPDA 1JXCA 2E3FA 1NGEA 2LI7A 2QWRA 4KYPA 1P00A 2E0HA 1HX1A 1LQIA 2M8BB 1NH5A 3GKUA 1ZU3A 3HSCA 5AQLA 4AAZA 5AQQA 1I2UA 1WMTA 2E2FA 3FZMA 2KGQA 4FL9A 3KVGA 1ICAA 5AQSA 1L4VA 3QFUA 2LJ7A 5F1XA 5BN9A 3FE1A 3ATUA 5AQUA 2YILA 4AB0A 1OZZA 3SF4D 5BPMA 1B7DA 5CY0A 2KBJA 3JXUA 5AQTA 3BK3C 1S3XA 5F0XA 1ZYWA 2ASCA 1JZBA 3QFPA 5BPNA 1TI5A 2JDQD 1DJTA 4H5TA 4HHFA 5AQMA 1WWNA 2I61A 2YC1C 1KAYA 2B68A 2KBKA 5F2RA 4HWIA 1NPIA 2GMOA 1JKZA 1T7AA 2QWMA 2A7TA 1YUWA 1HPMA 1BMRA 1SN4A 3LDQA 3KOZA 1C55A 1PX9A 4CQKA 2SN3A 3KOXA 5AQJA 2LY6A 1C56A 1ZYVA 3D2EB 1NGBA 3FZKA
chains in the Genus database with same CATH topology
2KBHA 2LT8A 1LQQA 1ZVGA 1CHZA 2KJAA 4AEIA 1GPSA 2N2RA 4HE7A 1VNAA 2LR3A 2N2QA 2B3CA 2NY9X 2NY8X 1ZFUA 1T7EA 2ATBA 1I6GA 1FH3A 1SN1A 1I2VA 1DQ7A 1B3CA 1T7BA 1MR4A 1VNBA 2KSKA 4V1DC 1T1TA 1P0AA 5KK4A 1PTXA 1BCGA 3E7UX 2MZ0A 2E3GA 2YBRC 1KV0A 3PSMA 1WT7A 2LY5A 1I6FA 4UJ0A 1SEGA 1N4NA 1AYJA 1SNBA 1NRBA 1BK8A 1AHOA 2N66A 1NE5A 1T0ZA 1ZUTA 2LJMA 2YEOA 1LQHA 1PE4A 1ZVEA 1CN2A 1BRZA 1NRAA 3E7RL 1GPTA 2LKBA 1OMYA 1JZAA 2GL1A 2N69A 2BRZA 1MYNA 2KPYA 2KYQA 1JXCA 2E3FA 2LI7A 4KYPA 1P00A 2E0HA 2M8BB 1LQIA 1NH5A 4AAZA 1ZU3A 1I2UA 1WMTA 1ICAA 1L4VA 2KGQA 2LJ7A 4AB0A 1OZZA 1B7DA 5CY0A 2KBJA 1ZYWA 2ASCA 1JZBA 1TI5A 1DJTA 4HHFA 1WWNA 2I61A 2YC1C 2B68A 2KBKA 1NPIA 1JKZA 1T7AA 2A7TA 1BMRA 1SN4A 1C55A 1PX9A 4CQKA 2SN3A 2LY6A 1C56A 1ZYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KBH A;  2LT8 A;  1LQQ A;  1ZVG A;  1CHZ A;  2KJA A;  4AEI A;  1GPS A;  2N2R A;  4HE7 A;  1VNA A;  2LR3 A;  2N2Q A;  2B3C A;  2NY9 X;  2NY8 X;  1ZFU A;  1T7E A;  2ATB A;  1I6G A;  1FH3 A;  1SN1 A;  1I2V A;  1DQ7 A;  1B3C A;  1T7B A;  1MR4 A;  1VNB A;  2KSK A;  4V1D C;  1T1T A;  1P0A A;  5KK4 A;  1PTX A;  1BCG A;  3E7U X;  2MZ0 A;  2E3G A;  2YBR C;  1KV0 A;  3PSM A;  1WT7 A;  2LY5 A;  1I6F A;  4UJ0 A;  1SEG A;  1N4N A;  1AYJ A;  1SNB A;  1NRB A;  1BK8 A;  1AHO A;  2N66 A;  1NE5 A;  1T0Z A;  1ZUT A;  2LJM A;  2YEO A;  1LQH A;  1PE4 A;  1ZVE A;  1CN2 A;  1BRZ A;  1NRA A;  3E7R L;  1GPT A;  2LKB A;  1OMY A;  1JZA A;  2GL1 A;  2N69 A;  2BRZ A;  1MYN A;  2KPY A;  2KYQ A;  1JXC A;  2E3F A;  2LI7 A;  4KYP A;  1P00 A;  2E0H A;  2M8B B;  1LQI A;  1NH5 A;  4AAZ A;  1ZU3 A;  1I2U A;  1WMT A;  1ICA A;  1L4V A;  2KGQ A;  2LJ7 A;  4AB0 A;  1OZZ A;  1B7D A;  5CY0 A;  2KBJ A;  1ZYW A;  2ASC A;  1JZB A;  1TI5 A;  1DJT A;  4HHF A;  1WWN A;  2I61 A;  2YC1 C;  2B68 A;  2KBK A;  1NPI A;  1JKZ A;  1T7A A;  2A7T A;  1BMR A;  1SN4 A;  1C55 A;  1PX9 A;  4CQK A;  2SN3 A;  2LY6 A;  1C56 A;  1ZYV A; 
#chains in the Genus database with same CATH topology
 2KBH A;  1HJO A;  4IO8 A;  2VY6 A;  2LT8 A;  1LQQ A;  1K8B A;  1ZVG A;  1CHZ A;  2KJA A;  4AEI A;  1NGH A;  1GPS A;  2N2R A;  3KC6 A;  2MN5 A;  3ATV A;  4HE7 A;  1VNA A;  2LR3 A;  2QW9 A;  2YIP A;  3D2E A;  3KP0 A;  5AQI A;  4UAF E;  5AQZ A;  3LDP A;  5BPL A;  2N2Q A;  2B3C A;  3LDO A;  5EXW A;  5EX5 A;  4H5W A;  5FPN A;  1POI A;  2NY9 X;  2E8A A;  1ATS A;  2NY8 X;  5AQK A;  1ZFU A;  1T7E A;  3QML A;  4H5R A;  2ATB A;  5BN8 A;  1I6G A;  1FH3 A;  2QWL A;  5AQV A;  3L4I A;  3LDN A;  3IUC A;  1NGG A;  1BA0 A;  1SN1 A;  1I2V A;  1QQO A;  3L6Q A;  1DQ7 A;  3FZL A;  3KOY A;  5AQO A;  1B3C A;  4UAE F;  3KHW A;  1T7B A;  5EY4 A;  1MR4 A;  1VNB A;  2KSK A;  4H5V A;  4V1D C;  5EVZ A;  1UGL A;  3GL1 A;  4GNI A;  1NGF A;  1T1T A;  3I33 A;  3CW4 A;  1P0A A;  1NGJ A;  3KOW A;  3L56 A;  5AQG A;  1PTX A;  1BCG A;  3E7U X;  4FSV A;  5AQX A;  1NGD A;  3C7N B;  2MZ0 A;  5KK4 A;  2E3G A;  4KBO A;  2QWN A;  2QXL A;  3A8Y A;  3GDQ A;  2BUP A;  2YBR C;  1KV0 A;  1NGC A;  3PSM A;  2QWP A;  1QQN A;  5AQP A;  1KAX A;  1BA1 A;  1WT7 A;  2LY5 A;  2MBK A;  3FZF A;  1I6F A;  4UJ0 A;  1SEG A;  1N4N A;  1AYJ A;  5AQH A;  1NGI A;  2YIO A;  1SNB A;  3C7N A;  5FPE A;  5AQY A;  3QI7 A;  3D2F B;  3CQX A;  1NRB A;  1XRS B;  5FPM A;  1BK8 A;  1AHO A;  2N66 A;  2QWO A;  4H5N A;  4UAD E;  5AQF A;  1NE5 A;  3R2V A;  5AQN A;  1T0Z A;  1ZUT A;  1KAZ A;  2LJM A;  2LN8 A;  3KP1 A;  1ATR A;  2YEO A;  3AY9 A;  1LQH A;  1PE4 A;  2E88 A;  1ZVE A;  1CN2 A;  1BRZ A;  1DKG D;  1NRA A;  2V7Z A;  3D2F A;  3E7R L;  1GPT A;  2QWQ A;  1NGA A;  2LKB A;  3M3Z A;  2KHO A;  1OMY A;  5AQW A;  1JZA A;  5AR0 A;  5AQR A;  2D56 A;  2GL1 A;  3FZH A;  1BUP A;  1QQM A;  2K35 A;  2G2K A;  2N69 A;  2BRZ A;  1MYN A;  2KPY A;  2KYQ A;  3LDL A;  5FPD A;  1JXC A;  2E3F A;  1NGE A;  2LI7 A;  2QWR A;  4KYP A;  1P00 A;  2E0H A;  1HX1 A;  1LQI A;  2M8B B;  1NH5 A;  3GKU A;  1ZU3 A;  3HSC A;  5AQL A;  4AAZ A;  5AQQ A;  1I2U A;  1WMT A;  2E2F A;  3FZM A;  2KGQ A;  4FL9 A;  3KVG A;  1ICA A;  5AQS A;  1L4V A;  3QFU A;  2LJ7 A;  5F1X A;  5BN9 A;  3FE1 A;  3ATU A;  5AQU A;  2YIL A;  4AB0 A;  1OZZ A;  3SF4 D;  5BPM A;  1B7D A;  5CY0 A;  2KBJ A;  3JXU A;  5AQT A;  3BK3 C;  1S3X A;  5F0X A;  1ZYW A;  2ASC A;  1JZB A;  3QFP A;  5BPN A;  1TI5 A;  2JDQ D;  1DJT A;  4H5T A;  4HHF A;  5AQM A;  1WWN A;  2I61 A;  2YC1 C;  1KAY A;  2B68 A;  2KBK A;  5F2R A;  4HWI A;  1NPI A;  2GMO A;  1JKZ A;  1T7A A;  2QWM A;  2A7T A;  1YUW A;  1HPM A;  1BMR A;  1SN4 A;  3LDQ A;  3KOZ A;  1C55 A;  1PX9 A;  4CQK A;  2SN3 A;  3KOX A;  5AQJ A;  2LY6 A;  1C56 A;  1ZYV A;  3D2E B;  1NGB A;  3FZK A; 
#chains in the Genus database with same CATH homology
 2KBH A;  2LT8 A;  1LQQ A;  1ZVG A;  1CHZ A;  2KJA A;  4AEI A;  1GPS A;  2N2R A;  4HE7 A;  1VNA A;  2LR3 A;  2N2Q A;  2B3C A;  2NY9 X;  2NY8 X;  1ZFU A;  1T7E A;  2ATB A;  1I6G A;  1FH3 A;  1SN1 A;  1I2V A;  1DQ7 A;  1B3C A;  1T7B A;  1MR4 A;  1VNB A;  2KSK A;  4V1D C;  1T1T A;  1P0A A;  5KK4 A;  1PTX A;  1BCG A;  3E7U X;  2MZ0 A;  2E3G A;  2YBR C;  1KV0 A;  3PSM A;  1WT7 A;  2LY5 A;  1I6F A;  4UJ0 A;  1SEG A;  1N4N A;  1AYJ A;  1SNB A;  1NRB A;  1BK8 A;  1AHO A;  2N66 A;  1NE5 A;  1T0Z A;  1ZUT A;  2LJM A;  2YEO A;  1LQH A;  1PE4 A;  1ZVE A;  1CN2 A;  1BRZ A;  1NRA A;  3E7R L;  1GPT A;  2LKB A;  1OMY A;  1JZA A;  2GL1 A;  2N69 A;  2BRZ A;  1MYN A;  2KPY A;  2KYQ A;  1JXC A;  2E3F A;  2LI7 A;  4KYP A;  1P00 A;  2E0H A;  2M8B B;  1LQI A;  1NH5 A;  4AAZ A;  1ZU3 A;  1I2U A;  1WMT A;  1ICA A;  1L4V A;  2KGQ A;  2LJ7 A;  4AB0 A;  1OZZ A;  1B7D A;  5CY0 A;  2KBJ A;  1ZYW A;  2ASC A;  1JZB A;  1TI5 A;  1DJT A;  4HHF A;  1WWN A;  2I61 A;  2YC1 C;  2B68 A;  2KBK A;  1NPI A;  1JKZ A;  1T7A A;  2A7T A;  1BMR A;  1SN4 A;  1C55 A;  1PX9 A;  4CQK A;  2SN3 A;  2LY6 A;  1C56 A;  1ZYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...