2GMOA

Nmr-structure of an independently folded c-terminal domain of influenza polymerase subunit pb2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
75
structure length
75
Chain Sequence
GVESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase basic protein 2
publication title Structure and nuclear import function of the C-terminal domain of influenza virus polymerase PB2 subunit.
pubmed doi rcsb
source organism Influenza a virus (a/victoria/3/1975(h3n2))
molecule tags Viral protein
total genus 5
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2006-04-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2gmoA01
2GMOA 3CW4A 4UAFE 3KC6A 4UAEF 2JDQD 3KHWA 2VY6A 3L56A 4UADE 3R2VA
chains in the Genus database with same CATH superfamily
1T0ZA 3KC6A 3C7NB 5AQHA 1AHOA 1JXCA 1YUWA 3FE1A 4HHFA 3ATUA 2QWMA 2V7ZA 5AQLA 1ZYVA 1KAZA 1PX9A 3FZHA 3GKUA 1ZFUA 5AQVA 5FPDA 1BUPA 1CHZA 1HX1A 1UGLA 1WWNA 1SN1A 3LDLA 5AQYA 3A8YA 2B68A 2KBJA 5AQIA 3E7RL 3CQXA 2MBKA 1JZAA 1KAXA 5AQFA 3BK3C 1ATSA 1NRBA 2KBKA 3SF4D 2YILA 2NY8X 4AB0A 1ZVEA 1JZBA 5AQQA 5FPMA 3D2EA 2SN3A 1C55A 3JXUA 1HPMA 3GDQA 2KJAA 3FZFA 5KK4A 1NGFA 1PTXA 3LDNA 1SNBA 3LDOA 1JKZA 3D2FA 3L56A 4UADE 1AYJA 1NGBA 3IUCA 5EXWA 1T1TA 4UAEF 5AQPA 2KYQA 2LT8A 5AQOA 1SEGA 2ATBA 2YIPA 1HJOA 1BA0A 5FPNA 2KBHA 1DJTA 4CQKA 2QXLA 5AQKA 5EVZA 2QWRA 1SN4A 5AQUA 1N4NA 2QWOA 2MN5A 3HSCA 1KV0A 1P0AA 1B7DA 1B3CA 3KOZA 3FZMA 5AQRA 1LQHA 2KPYA 4FL9A 5F0XA 2N2RA 2QWLA 5BN8A 2LJ7A 5AQZA 3QI7A 3R2VA 5AQJA 4UJ0A 1MYNA 4UAFE 1C56A 2GL1A 5AQGA 2N2QA 1T7EA 1VNBA 1XRSB 2E88A 2LY6A 3KHWA 2LJMA 2MZ0A 4GNIA 1POIA 2D56A 5AQMA 1ICAA 3GL1A 3KOYA 2N66A 3KOXA 1LQQA 1QQNA 4H5WA 2NY9X 2M8BB 2E2FA 3FZLA 4H5TA 5F1XA 4H5NA 1LQIA 1ZVGA 4AEIA 1I6GA 3D2FB 1NGIA 5BPNA 1NH5A 1PE4A 2E8AA 1CN2A 1MR4A 4V1DC 5AQWA 4HWIA 2QW9A 1BA1A 5AQNA 1L4VA 2VY6A 1OMYA 2K35A 3E7UX 3I33A 3L4IA 3KP0A 1GPSA 2E3FA 1FH3A 3FZKA 1WMTA 2BUPA 1NGAA 3L6QA 2KHOA 2KSKA 1ZUTA 2QWPA 2LI7A 1DKGD 2LY5A 2N69A 3QFUA 2LN8A 2YBRC 2B3CA 1BCGA 1OZZA 2BRZA 2YIOA 3C7NA 2I61A 2QWNA 3AY9A 4H5RA 1DQ7A 1NGDA 5F2RA 5BN9A 5EX5A 2YC1C 1NGHA 1NE5A 1NGJA 1QQOA 2G2KA 1QQMA 3D2EB 3LDPA 1BMRA 1KAYA 3KVGA 4KYPA 1VNAA 1BRZA 1TI5A 1T7AA 3KP1A 4H5VA 1ZU3A 1NGEA 4AAZA 1GPTA 3CW4A 3QMLA 1NGGA 2ASCA 5CY0A 3M3ZA 1T7BA 2E3GA 3LDQA 4IO8A 5AQSA 2GMOA 4HE7A 1P00A 4FSVA 2KGQA 1I6FA 1NRAA 4KBOA 1K8BA 2E0HA 2JDQD 2YEOA 5EY4A 5AR0A 3QFPA 5FPEA 1BK8A 1ZYWA 1WT7A 1NPIA 1NGCA 1S3XA 3KOWA 2A7TA 2QWQA 3PSMA 5AQTA 5AQXA 5BPMA 3ATVA 5BPLA 1I2VA 1ATRA 1I2UA 2LKBA 2LR3A
chains in the Genus database with same CATH topology
3KC6A 3C7NB 5AQHA 1YUWA 3FE1A 3ATUA 2QWMA 2V7ZA 5AQLA 1KAZA 3FZHA 5AQVA 5FPDA 1BUPA 1HX1A 3LDLA 5AQYA 3A8YA 5AQIA 3CQXA 2MBKA 5AQFA 1KAXA 3BK3C 1ATSA 3SF4D 2YILA 5AQQA 5FPMA 3D2EA 3JXUA 1HPMA 3GDQA 3FZFA 1NGFA 3LDNA 3LDOA 3D2FA 3L56A 4UADE 1NGBA 3IUCA 5EXWA 4UAEF 5AQPA 5AQOA 2YIPA 1HJOA 1BA0A 5FPNA 2QXLA 5AQKA 5EVZA 2QWRA 5AQUA 2QWOA 2MN5A 3HSCA 3FZMA 5AQRA 4FL9A 5F0XA 2QWLA 5BN8A 5AQZA 3QI7A 3R2VA 5AQJA 4UAFE 5AQGA 2E88A 3KHWA 5AQMA 4GNIA 1POIA 2D56A 3GL1A 4H5WA 1QQNA 2E2FA 3FZLA 4H5TA 5F1XA 4H5NA 3D2FB 1NGIA 5BPNA 2E8AA 5AQWA 4HWIA 2QW9A 1BA1A 5AQNA 2VY6A 2K35A 3I33A 3L4IA 3FZKA 2BUPA 1NGAA 3L6QA 2KHOA 2QWPA 1DKGD 3QFUA 2LN8A 3C7NA 4H5RA 2YIOA 5F2RA 2QWNA 3AY9A 1NGDA 5BN9A 5EX5A 1NGHA 1NGJA 1QQOA 1QQMA 3D2EB 3LDPA 1KAYA 3KVGA 4H5VA 1NGEA 3CW4A 3QMLA 1NGGA 3M3ZA 3LDQA 4IO8A 5AQSA 2GMOA 4FSVA 4KBOA 2JDQD 5EY4A 5AR0A 3QFPA 5FPEA 1S3XA 1NGCA 5AQXA 5AQTA 2QWQA 5BPLA 5BPMA 3ATVA 1ATRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GMO A;  3CW4 A;  4UAF E;  3KC6 A;  4UAE F;  2JDQ D;  3KHW A;  2VY6 A;  3L56 A;  4UAD E;  3R2V A; 
#chains in the Genus database with same CATH topology
 1T0Z A;  3KC6 A;  3C7N B;  5AQH A;  1AHO A;  1JXC A;  1YUW A;  3FE1 A;  4HHF A;  3ATU A;  2QWM A;  2V7Z A;  5AQL A;  1ZYV A;  1KAZ A;  1PX9 A;  3FZH A;  3GKU A;  1ZFU A;  5AQV A;  5FPD A;  1BUP A;  1CHZ A;  1HX1 A;  1UGL A;  1WWN A;  1SN1 A;  3LDL A;  5AQY A;  3A8Y A;  2B68 A;  2KBJ A;  5AQI A;  3E7R L;  3CQX A;  2MBK A;  1JZA A;  1KAX A;  5AQF A;  3BK3 C;  1ATS A;  1NRB A;  2KBK A;  3SF4 D;  2YIL A;  2NY8 X;  4AB0 A;  1ZVE A;  1JZB A;  5AQQ A;  5FPM A;  3D2E A;  2SN3 A;  1C55 A;  3JXU A;  1HPM A;  3GDQ A;  2KJA A;  3FZF A;  5KK4 A;  1NGF A;  1PTX A;  3LDN A;  1SNB A;  3LDO A;  1JKZ A;  3D2F A;  3L56 A;  4UAD E;  1AYJ A;  1NGB A;  3IUC A;  5EXW A;  1T1T A;  4UAE F;  5AQP A;  2KYQ A;  2LT8 A;  5AQO A;  1SEG A;  2ATB A;  2YIP A;  1HJO A;  1BA0 A;  5FPN A;  2KBH A;  1DJT A;  4CQK A;  2QXL A;  5AQK A;  5EVZ A;  2QWR A;  1SN4 A;  5AQU A;  1N4N A;  2QWO A;  2MN5 A;  3HSC A;  1KV0 A;  1P0A A;  1B7D A;  1B3C A;  3KOZ A;  3FZM A;  5AQR A;  1LQH A;  2KPY A;  4FL9 A;  5F0X A;  2N2R A;  2QWL A;  5BN8 A;  2LJ7 A;  5AQZ A;  3QI7 A;  3R2V A;  5AQJ A;  4UJ0 A;  1MYN A;  4UAF E;  1C56 A;  2GL1 A;  5AQG A;  2N2Q A;  1T7E A;  1VNB A;  1XRS B;  2E88 A;  2LY6 A;  3KHW A;  2LJM A;  2MZ0 A;  4GNI A;  1POI A;  2D56 A;  5AQM A;  1ICA A;  3GL1 A;  3KOY A;  2N66 A;  3KOX A;  1LQQ A;  1QQN A;  4H5W A;  2NY9 X;  2M8B B;  2E2F A;  3FZL A;  4H5T A;  5F1X A;  4H5N A;  1LQI A;  1ZVG A;  4AEI A;  1I6G A;  3D2F B;  1NGI A;  5BPN A;  1NH5 A;  1PE4 A;  2E8A A;  1CN2 A;  1MR4 A;  4V1D C;  5AQW A;  4HWI A;  2QW9 A;  1BA1 A;  5AQN A;  1L4V A;  2VY6 A;  1OMY A;  2K35 A;  3E7U X;  3I33 A;  3L4I A;  3KP0 A;  1GPS A;  2E3F A;  1FH3 A;  3FZK A;  1WMT A;  2BUP A;  1NGA A;  3L6Q A;  2KHO A;  2KSK A;  1ZUT A;  2QWP A;  2LI7 A;  1DKG D;  2LY5 A;  2N69 A;  3QFU A;  2LN8 A;  2YBR C;  2B3C A;  1BCG A;  1OZZ A;  2BRZ A;  2YIO A;  3C7N A;  2I61 A;  2QWN A;  3AY9 A;  4H5R A;  1DQ7 A;  1NGD A;  5F2R A;  5BN9 A;  5EX5 A;  2YC1 C;  1NGH A;  1NE5 A;  1NGJ A;  1QQO A;  2G2K A;  1QQM A;  3D2E B;  3LDP A;  1BMR A;  1KAY A;  3KVG A;  4KYP A;  1VNA A;  1BRZ A;  1TI5 A;  1T7A A;  3KP1 A;  4H5V A;  1ZU3 A;  1NGE A;  4AAZ A;  1GPT A;  3CW4 A;  3QML A;  1NGG A;  2ASC A;  5CY0 A;  3M3Z A;  1T7B A;  2E3G A;  3LDQ A;  4IO8 A;  5AQS A;  2GMO A;  4HE7 A;  1P00 A;  4FSV A;  2KGQ A;  1I6F A;  1NRA A;  4KBO A;  1K8B A;  2E0H A;  2JDQ D;  2YEO A;  5EY4 A;  5AR0 A;  3QFP A;  5FPE A;  1BK8 A;  1ZYW A;  1WT7 A;  1NPI A;  1NGC A;  1S3X A;  3KOW A;  2A7T A;  2QWQ A;  3PSM A;  5AQT A;  5AQX A;  5BPM A;  3ATV A;  5BPL A;  1I2V A;  1ATR A;  1I2U A;  2LKB A;  2LR3 A; 
#chains in the Genus database with same CATH homology
 3KC6 A;  3C7N B;  5AQH A;  1YUW A;  3FE1 A;  3ATU A;  2QWM A;  2V7Z A;  5AQL A;  1KAZ A;  3FZH A;  5AQV A;  5FPD A;  1BUP A;  1HX1 A;  3LDL A;  5AQY A;  3A8Y A;  5AQI A;  3CQX A;  2MBK A;  5AQF A;  1KAX A;  3BK3 C;  1ATS A;  3SF4 D;  2YIL A;  5AQQ A;  5FPM A;  3D2E A;  3JXU A;  1HPM A;  3GDQ A;  3FZF A;  1NGF A;  3LDN A;  3LDO A;  3D2F A;  3L56 A;  4UAD E;  1NGB A;  3IUC A;  5EXW A;  4UAE F;  5AQP A;  5AQO A;  2YIP A;  1HJO A;  1BA0 A;  5FPN A;  2QXL A;  5AQK A;  5EVZ A;  2QWR A;  5AQU A;  2QWO A;  2MN5 A;  3HSC A;  3FZM A;  5AQR A;  4FL9 A;  5F0X A;  2QWL A;  5BN8 A;  5AQZ A;  3QI7 A;  3R2V A;  5AQJ A;  4UAF E;  5AQG A;  2E88 A;  3KHW A;  5AQM A;  4GNI A;  1POI A;  2D56 A;  3GL1 A;  4H5W A;  1QQN A;  2E2F A;  3FZL A;  4H5T A;  5F1X A;  4H5N A;  3D2F B;  1NGI A;  5BPN A;  2E8A A;  5AQW A;  4HWI A;  2QW9 A;  1BA1 A;  5AQN A;  2VY6 A;  2K35 A;  3I33 A;  3L4I A;  3FZK A;  2BUP A;  1NGA A;  3L6Q A;  2KHO A;  2QWP A;  1DKG D;  3QFU A;  2LN8 A;  3C7N A;  4H5R A;  2YIO A;  5F2R A;  2QWN A;  3AY9 A;  1NGD A;  5BN9 A;  5EX5 A;  1NGH A;  1NGJ A;  1QQO A;  1QQM A;  3D2E B;  3LDP A;  1KAY A;  3KVG A;  4H5V A;  1NGE A;  3CW4 A;  3QML A;  1NGG A;  3M3Z A;  3LDQ A;  4IO8 A;  5AQS A;  2GMO A;  4FSV A;  4KBO A;  2JDQ D;  5EY4 A;  5AR0 A;  3QFP A;  5FPE A;  1S3X A;  1NGC A;  5AQX A;  5AQT A;  2QWQ A;  5BPL A;  5BPM A;  3ATV A;  1ATR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...