1ZU3A

Crystal structure of mutant k8a of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
64
structure length
64
Chain Sequence
VRDAYIAAPHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Alpha-like neurotoxin BmK-I
publication title Structural basis for the voltage-gated Na+ channel selectivity of the scorpion alpha-like toxin BmK M1
pubmed doi rcsb
source organism Mesobuthus martensii
total genus 15
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2005-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1zu3A00
1T1TA 2B3CA 2LY6A 1OZZA 1C55A 1P00A 1LQIA 1MYNA 1I6GA 3E7UX 4AAZA 1LQHA 4HHFA 1ICAA 1GPSA 4AB0A 1I2VA 2LKBA 1GPTA 4KYPA 1P0AA 1T7AA 2N69A 1ZVGA 2E3GA 1DJTA 2M8BB 1CHZA 1TI5A 1JZBA 4CQKA 1ZYVA 1CN2A 1C56A 3PSMA 1BCGA 2A7TA 2BRZA 2YBRC 1FH3A 1I6FA 1WT7A 1MR4A 1OMYA 2N66A 2I61A 2LY5A 2KBHA 4UJ0A 1I2UA 2LI7A 1SNBA 2N2RA 2YC1C 2B68A 2LJMA 5KK4A 1LQQA 2LJ7A 2MZ0A 2N2QA 2E3FA 2YEOA 2KBKA 1BRZA 1JZAA 1B3CA 4AEIA 1NH5A 1PX9A 1NPIA 1JKZA 1ZUTA 2E0HA 1JXCA 2KGQA 1KV0A 2KSKA 4HE7A 5CY0A 1WMTA 2NY9X 1NE5A 2NY8X 1VNAA 1SEGA 2KPYA 1NRBA 1AYJA 3E7RL 2ASCA 2KYQA 1VNBA 1L4VA 1DQ7A 1BMRA 1ZU3A 2KBJA 2LT8A 1WWNA 1AHOA 2GL1A 2SN3A 1ZFUA 1T0ZA 2LR3A 4V1DC 1PE4A 1T7EA 2ATBA 1SN1A 1NRAA 1BK8A 1B7DA 2KJAA 1ZYWA 1N4NA 1SN4A 1T7BA 1ZVEA 1PTXA
chains in the Genus database with same CATH superfamily
5AQNA 1T1TA 3CW4A 2B3CA 2LY6A 2QWLA 1XRSB 4UAFE 1OZZA 4UADE 1C55A 5EX5A 2LN8A 1P00A 5FPEA 3QI7A 1LQIA 1MYNA 1KAYA 3KOYA 5AR0A 1I6GA 3FZFA 3FZLA 3JXUA 1S3XA 2E88A 4UAEF 3D2EA 5F2RA 3E7UX 3GL1A 1NGBA 3QFPA 5BPMA 3ATVA 3ATUA 3LDOA 1NGHA 4AAZA 1LQHA 4HHFA 5AQOA 1NGIA 1ICAA 5AQIA 3KC6A 2D56A 3KHWA 5AQVA 2QWNA 1GPSA 3AY9A 1BUPA 3C7NA 4AB0A 1I2VA 2LKBA 3LDNA 5AQHA 1QQMA 2QWOA 1GPTA 4KYPA 1P0AA 1T7AA 2N69A 1NGGA 1ZVGA 2E3GA 1DJTA 1ATRA 2M8BB 3FZKA 3FZHA 1CHZA 1TI5A 1POIA 1JZBA 1NGDA 1ZYVA 2MBKA 1C56A 1ATSA 1BCGA 1HPMA 1YUWA 3PSMA 4H5NA 5BN8A 3D2EB 2A7TA 5AQXA 1QQNA 4GNIA 4H5TA 2BRZA 5AQKA 5AQWA 5FPNA 1CN2A 2YBRC 5AQFA 3KOXA 1FH3A 1I6FA 1KAXA 1QQOA 1WT7A 3FZMA 3C7NB 1BA1A 1MR4A 5BPNA 5EXWA 1OMYA 2N66A 1JKZA 2I61A 3HSCA 2LY5A 2QXLA 3IUCA 4KBOA 3D2FA 2KBHA 5AQSA 4UJ0A 1I2UA 1SNBA 2LI7A 2N2RA 2V7ZA 2YC1C 3A8YA 5AQQA 2B68A 2LJMA 5AQPA 3QFUA 1K8BA 3I33A 5KK4A 1LQQA 2LJ7A 2MZ0A 2N2QA 3KP0A 1UGLA 5AQJA 2E3FA 2E8AA 2QWMA 2YIPA 3KOZA 1NGEA 2YEOA 2KBKA 3LDQA 3R2VA 2YILA 5AQYA 1BRZA 1NGJA 5AQRA 5AQUA 2KHOA 2QWQA 5AQGA 2MN5A 1JZAA 1B3CA 3KVGA 3KP1A 5AQMA 5FPMA 4H5RA 4AEIA 1NH5A 1PX9A 1NPIA 2JDQD 4IO8A 3BK3C 3D2FB 1ZUTA 2VY6A 2YIOA 1HJOA 2E0HA 1JXCA 2K35A 4FL9A 5AQLA 5EVZA 5FPDA 2KGQA 1KV0A 2KSKA 4HE7A 5F1XA 2BUPA 5CY0A 1WMTA 5AQTA 3GKUA 2NY9X 1NE5A 2GMOA 2NY8X 3LDLA 5BPLA 1VNAA 1SEGA 2KPYA 1KAZA 1NRBA 1AYJA 3E7RL 2ASCA 3LDPA 2KYQA 1VNBA 1L4VA 1DQ7A 3L4IA 4H5VA 1BMRA 2QWRA 1BA0A 1HX1A 1NGCA 1ZU3A 2KBJA 3SF4D 4CQKA 3M3ZA 2LT8A 3L56A 1WWNA 3QMLA 2QWPA 4H5WA 1AHOA 2E2FA 4HWIA 2G2KA 3GDQA 2GL1A 3L6QA 2SN3A 3KOWA 1NGAA 1ZFUA 1NGFA 1T0ZA 2LR3A 4V1DC 1DKGD 1PE4A 1T7EA 2ATBA 1SN1A 1NRAA 5F0XA 1BK8A 2QW9A 4FSVA 5AQZA 1B7DA 2KJAA 1ZYWA 3CQXA 1N4NA 1SN4A 1T7BA 1ZVEA 5BN9A 5EY4A 1PTXA 3FE1A
chains in the Genus database with same CATH topology
1T1TA 2B3CA 2LY6A 1OZZA 1C55A 1P00A 1LQIA 1MYNA 1I6GA 3E7UX 4AAZA 1LQHA 4HHFA 1ICAA 1GPSA 4AB0A 1I2VA 2LKBA 1GPTA 4KYPA 1P0AA 1T7AA 2N69A 1ZVGA 2E3GA 1DJTA 2M8BB 1CHZA 1TI5A 1JZBA 4CQKA 1ZYVA 1CN2A 1C56A 3PSMA 1BCGA 2A7TA 2BRZA 2YBRC 1FH3A 1I6FA 1WT7A 1MR4A 1OMYA 2N66A 2I61A 2LY5A 2KBHA 4UJ0A 1I2UA 2LI7A 1SNBA 2N2RA 2YC1C 2B68A 2LJMA 5KK4A 1LQQA 2LJ7A 2MZ0A 2N2QA 2E3FA 2YEOA 2KBKA 1BRZA 1JZAA 1B3CA 4AEIA 1NH5A 1PX9A 1NPIA 1JKZA 1ZUTA 2E0HA 1JXCA 2KGQA 1KV0A 2KSKA 4HE7A 5CY0A 1WMTA 2NY9X 1NE5A 2NY8X 1VNAA 1SEGA 2KPYA 1NRBA 1AYJA 3E7RL 2ASCA 2KYQA 1VNBA 1L4VA 1DQ7A 1BMRA 1ZU3A 2KBJA 2LT8A 1WWNA 1AHOA 2GL1A 2SN3A 1ZFUA 1T0ZA 2LR3A 4V1DC 1PE4A 1T7EA 2ATBA 1SN1A 1NRAA 1BK8A 1B7DA 2KJAA 1ZYWA 1N4NA 1SN4A 1T7BA 1ZVEA 1PTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T1T A;  2B3C A;  2LY6 A;  1OZZ A;  1C55 A;  1P00 A;  1LQI A;  1MYN A;  1I6G A;  3E7U X;  4AAZ A;  1LQH A;  4HHF A;  1ICA A;  1GPS A;  4AB0 A;  1I2V A;  2LKB A;  1GPT A;  4KYP A;  1P0A A;  1T7A A;  2N69 A;  1ZVG A;  2E3G A;  1DJT A;  2M8B B;  1CHZ A;  1TI5 A;  1JZB A;  4CQK A;  1ZYV A;  1CN2 A;  1C56 A;  3PSM A;  1BCG A;  2A7T A;  2BRZ A;  2YBR C;  1FH3 A;  1I6F A;  1WT7 A;  1MR4 A;  1OMY A;  2N66 A;  2I61 A;  2LY5 A;  2KBH A;  4UJ0 A;  1I2U A;  2LI7 A;  1SNB A;  2N2R A;  2YC1 C;  2B68 A;  2LJM A;  5KK4 A;  1LQQ A;  2LJ7 A;  2MZ0 A;  2N2Q A;  2E3F A;  2YEO A;  2KBK A;  1BRZ A;  1JZA A;  1B3C A;  4AEI A;  1NH5 A;  1PX9 A;  1NPI A;  1JKZ A;  1ZUT A;  2E0H A;  1JXC A;  2KGQ A;  1KV0 A;  2KSK A;  4HE7 A;  5CY0 A;  1WMT A;  2NY9 X;  1NE5 A;  2NY8 X;  1VNA A;  1SEG A;  2KPY A;  1NRB A;  1AYJ A;  3E7R L;  2ASC A;  2KYQ A;  1VNB A;  1L4V A;  1DQ7 A;  1BMR A;  1ZU3 A;  2KBJ A;  2LT8 A;  1WWN A;  1AHO A;  2GL1 A;  2SN3 A;  1ZFU A;  1T0Z A;  2LR3 A;  4V1D C;  1PE4 A;  1T7E A;  2ATB A;  1SN1 A;  1NRA A;  1BK8 A;  1B7D A;  2KJA A;  1ZYW A;  1N4N A;  1SN4 A;  1T7B A;  1ZVE A;  1PTX A; 
#chains in the Genus database with same CATH topology
 5AQN A;  1T1T A;  3CW4 A;  2B3C A;  2LY6 A;  2QWL A;  1XRS B;  4UAF E;  1OZZ A;  4UAD E;  1C55 A;  5EX5 A;  2LN8 A;  1P00 A;  5FPE A;  3QI7 A;  1LQI A;  1MYN A;  1KAY A;  3KOY A;  5AR0 A;  1I6G A;  3FZF A;  3FZL A;  3JXU A;  1S3X A;  2E88 A;  4UAE F;  3D2E A;  5F2R A;  3E7U X;  3GL1 A;  1NGB A;  3QFP A;  5BPM A;  3ATV A;  3ATU A;  3LDO A;  1NGH A;  4AAZ A;  1LQH A;  4HHF A;  5AQO A;  1NGI A;  1ICA A;  5AQI A;  3KC6 A;  2D56 A;  3KHW A;  5AQV A;  2QWN A;  1GPS A;  3AY9 A;  1BUP A;  3C7N A;  4AB0 A;  1I2V A;  2LKB A;  3LDN A;  5AQH A;  1QQM A;  2QWO A;  1GPT A;  4KYP A;  1P0A A;  1T7A A;  2N69 A;  1NGG A;  1ZVG A;  2E3G A;  1DJT A;  1ATR A;  2M8B B;  3FZK A;  3FZH A;  1CHZ A;  1TI5 A;  1POI A;  1JZB A;  1NGD A;  1ZYV A;  2MBK A;  1C56 A;  1ATS A;  1BCG A;  1HPM A;  1YUW A;  3PSM A;  4H5N A;  5BN8 A;  3D2E B;  2A7T A;  5AQX A;  1QQN A;  4GNI A;  4H5T A;  2BRZ A;  5AQK A;  5AQW A;  5FPN A;  1CN2 A;  2YBR C;  5AQF A;  3KOX A;  1FH3 A;  1I6F A;  1KAX A;  1QQO A;  1WT7 A;  3FZM A;  3C7N B;  1BA1 A;  1MR4 A;  5BPN A;  5EXW A;  1OMY A;  2N66 A;  1JKZ A;  2I61 A;  3HSC A;  2LY5 A;  2QXL A;  3IUC A;  4KBO A;  3D2F A;  2KBH A;  5AQS A;  4UJ0 A;  1I2U A;  1SNB A;  2LI7 A;  2N2R A;  2V7Z A;  2YC1 C;  3A8Y A;  5AQQ A;  2B68 A;  2LJM A;  5AQP A;  3QFU A;  1K8B A;  3I33 A;  5KK4 A;  1LQQ A;  2LJ7 A;  2MZ0 A;  2N2Q A;  3KP0 A;  1UGL A;  5AQJ A;  2E3F A;  2E8A A;  2QWM A;  2YIP A;  3KOZ A;  1NGE A;  2YEO A;  2KBK A;  3LDQ A;  3R2V A;  2YIL A;  5AQY A;  1BRZ A;  1NGJ A;  5AQR A;  5AQU A;  2KHO A;  2QWQ A;  5AQG A;  2MN5 A;  1JZA A;  1B3C A;  3KVG A;  3KP1 A;  5AQM A;  5FPM A;  4H5R A;  4AEI A;  1NH5 A;  1PX9 A;  1NPI A;  2JDQ D;  4IO8 A;  3BK3 C;  3D2F B;  1ZUT A;  2VY6 A;  2YIO A;  1HJO A;  2E0H A;  1JXC A;  2K35 A;  4FL9 A;  5AQL A;  5EVZ A;  5FPD A;  2KGQ A;  1KV0 A;  2KSK A;  4HE7 A;  5F1X A;  2BUP A;  5CY0 A;  1WMT A;  5AQT A;  3GKU A;  2NY9 X;  1NE5 A;  2GMO A;  2NY8 X;  3LDL A;  5BPL A;  1VNA A;  1SEG A;  2KPY A;  1KAZ A;  1NRB A;  1AYJ A;  3E7R L;  2ASC A;  3LDP A;  2KYQ A;  1VNB A;  1L4V A;  1DQ7 A;  3L4I A;  4H5V A;  1BMR A;  2QWR A;  1BA0 A;  1HX1 A;  1NGC A;  1ZU3 A;  2KBJ A;  3SF4 D;  4CQK A;  3M3Z A;  2LT8 A;  3L56 A;  1WWN A;  3QML A;  2QWP A;  4H5W A;  1AHO A;  2E2F A;  4HWI A;  2G2K A;  3GDQ A;  2GL1 A;  3L6Q A;  2SN3 A;  3KOW A;  1NGA A;  1ZFU A;  1NGF A;  1T0Z A;  2LR3 A;  4V1D C;  1DKG D;  1PE4 A;  1T7E A;  2ATB A;  1SN1 A;  1NRA A;  5F0X A;  1BK8 A;  2QW9 A;  4FSV A;  5AQZ A;  1B7D A;  2KJA A;  1ZYW A;  3CQX A;  1N4N A;  1SN4 A;  1T7B A;  1ZVE A;  5BN9 A;  5EY4 A;  1PTX A;  3FE1 A; 
#chains in the Genus database with same CATH homology
 1T1T A;  2B3C A;  2LY6 A;  1OZZ A;  1C55 A;  1P00 A;  1LQI A;  1MYN A;  1I6G A;  3E7U X;  4AAZ A;  1LQH A;  4HHF A;  1ICA A;  1GPS A;  4AB0 A;  1I2V A;  2LKB A;  1GPT A;  4KYP A;  1P0A A;  1T7A A;  2N69 A;  1ZVG A;  2E3G A;  1DJT A;  2M8B B;  1CHZ A;  1TI5 A;  1JZB A;  4CQK A;  1ZYV A;  1CN2 A;  1C56 A;  3PSM A;  1BCG A;  2A7T A;  2BRZ A;  2YBR C;  1FH3 A;  1I6F A;  1WT7 A;  1MR4 A;  1OMY A;  2N66 A;  2I61 A;  2LY5 A;  2KBH A;  4UJ0 A;  1I2U A;  2LI7 A;  1SNB A;  2N2R A;  2YC1 C;  2B68 A;  2LJM A;  5KK4 A;  1LQQ A;  2LJ7 A;  2MZ0 A;  2N2Q A;  2E3F A;  2YEO A;  2KBK A;  1BRZ A;  1JZA A;  1B3C A;  4AEI A;  1NH5 A;  1PX9 A;  1NPI A;  1JKZ A;  1ZUT A;  2E0H A;  1JXC A;  2KGQ A;  1KV0 A;  2KSK A;  4HE7 A;  5CY0 A;  1WMT A;  2NY9 X;  1NE5 A;  2NY8 X;  1VNA A;  1SEG A;  2KPY A;  1NRB A;  1AYJ A;  3E7R L;  2ASC A;  2KYQ A;  1VNB A;  1L4V A;  1DQ7 A;  1BMR A;  1ZU3 A;  2KBJ A;  2LT8 A;  1WWN A;  1AHO A;  2GL1 A;  2SN3 A;  1ZFU A;  1T0Z A;  2LR3 A;  4V1D C;  1PE4 A;  1T7E A;  2ATB A;  1SN1 A;  1NRA A;  1BK8 A;  1B7D A;  2KJA A;  1ZYW A;  1N4N A;  1SN4 A;  1T7B A;  1ZVE A;  1PTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...