3KHWA

Crystal structure of the large c-terminal domain of polymerase basic protein 2 from influenza virus a/mexico/indre4487/2009(h1n1)
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
201
structure length
201
Chain Sequence
GPESVLVNTYQWIIRNWEIVKIQWSQDPTMLYNKMEFEPFQSLVPKATRSRYSGFVRTLFQQMRDVLGTFDTVQIIKLLPFAAAPPEQSRMQFSSLTVNVRGSGLRILVRGNSPVFNYNKATKRLTVLGKDAGALTEDPDEGTSGVESAVLRGFLILGKEDKRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polymerase PB2
publication title Biological and structural characterization of a host-adapting amino acid in influenza virus.
pubmed doi rcsb
source organism Influenza a virus (a/mexico/indre4487/2009(h1n1))
molecule tags Viral protein
total genus 54
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 3khwA02
3L56A 4UAFE 2JDQD 4UADE 2VY6A 3KHWA 3KC6A 2GMOA 3R2VA 3CW4A 4UAEF
chains in the Genus database with same CATH superfamily
1B7DA 5AQVA 1TI5A 1B3CA 1NGDA 3FZFA 2VY6A 5AQZA 3GDQA 1ZYVA 4FSVA 1ICAA 3JXUA 1ZVEA 1JZAA 2M8BB 3LDQA 5AQNA 1CN2A 2E0HA 1NGGA 2QXLA 5AQHA 3AY9A 1SN1A 3KVGA 2QWMA 1QQMA 3FE1A 1NGCA 4IO8A 5EX5A 1BK8A 1VNAA 1DJTA 1LQQA 5FPMA 1VNBA 1WMTA 5F1XA 5AQYA 2LY6A 2YIOA 1PTXA 2BRZA 2QWOA 5AQTA 3GKUA 1AHOA 1I6FA 1POIA 3KHWA 3D2FA 5AQIA 1BMRA 1KAZA 1C56A 1KAXA 1NRAA 1ZVGA 3M3ZA 1GPSA 1K8BA 1NGHA 1UGLA 3E7UX 2B3CA 2LKBA 3LDNA 3QMLA 3L6QA 1LQHA 5AQFA 2V7ZA 3QFUA 4GNIA 1LQIA 3BK3C 1HX1A 3KC6A 4H5NA 3GL1A 2LR3A 2I61A 5AQXA 4UAEF 2QWNA 2NY8X 1BUPA 3E7RL 5F2RA 1KV0A 5EY4A 4UJ0A 1WWNA 3L4IA 1NE5A 2ATBA 2N69A 2E88A 2MBKA 2QWPA 3C7NB 3D2EA 1QQNA 3KOZA 4UADE 5EVZA 2LT8A 2KGQA 4AB0A 1I2VA 2YBRC 5AQKA 2B68A 1XRSB 1C55A 1OZZA 4H5RA 1FH3A 1P0AA 5FPEA 1JKZA 1ZFUA 1MR4A 3KOXA 4H5VA 1AYJA 1PX9A 5AQUA 5AQSA 4CQKA 1GPTA 2GMOA 2KJAA 5AQPA 1ATSA 2YEOA 3ATVA 2LY5A 5FPNA 1NGAA 2A7TA 3PSMA 4KBOA 3FZLA 5AQJA 2QWQA 1L4VA 1BCGA 2K35A 3HSCA 4AAZA 5AQOA 1BA1A 2E3FA 3L56A 4H5TA 2D56A 1NGBA 3KP1A 5BPLA 2KHOA 2MZ0A 1NGFA 1T7EA 5CY0A 2KBJA 1I6GA 3LDOA 2BUPA 3QFPA 1HPMA 2JDQD 4UAFE 3R2VA 5BPNA 1HJOA 1N4NA 1BRZA 5AQMA 2G2KA 5AQRA 3LDPA 3CW4A 5BPMA 3QI7A 3A8YA 3IUCA 2QW9A 2YILA 1ATRA 1NH5A 1KAYA 2KPYA 3C7NA 1DKGD 4FL9A 3D2FB 1OMYA 4KYPA 1JZBA 5EXWA 1JXCA 4HWIA 2LJ7A 3FZKA 3CQXA 1YUWA 1BA0A 1NGEA 2GL1A 5AQQA 1ZUTA 2NY9X 5AQWA 1WT7A 1ZYWA 1SNBA 4H5WA 4V1DC 1MYNA 1NGIA 1P00A 2SN3A 5KK4A 5AQGA 4HE7A 1NPIA 2E3GA 3I33A 5FPDA 3KOYA 1SEGA 1QQOA 1NGJA 1T1TA 1T0ZA 2LJMA 1NRBA 2MN5A 2N2RA 2E8AA 2KSKA 2LN8A 3D2EB 2QWLA 3ATUA 3KOWA 1T7AA 2QWRA 3KP0A 2YIPA 5BN9A 2YC1C 1ZU3A 1CHZA 2LI7A 2N66A 4AEIA 1I2UA 3LDLA 2KYQA 4HHFA 2E2FA 3FZMA 3SF4D 1S3XA 5F0XA 1PE4A 1DQ7A 1SN4A 2ASCA 2KBHA 2KBKA 2N2QA 3FZHA 5AQLA 1T7BA 5AR0A 5BN8A
chains in the Genus database with same CATH topology
5AQVA 1NGDA 3FZFA 2VY6A 5AQZA 3GDQA 4FSVA 3JXUA 3LDQA 5AQNA 5AQHA 1NGGA 2QXLA 5EX5A 3AY9A 3KVGA 2QWMA 1QQMA 3FE1A 1NGCA 4IO8A 5FPMA 5F1XA 5AQYA 2YIOA 2QWOA 5AQTA 3KHWA 1POIA 5AQIA 3D2FA 1KAZA 1KAXA 3M3ZA 1NGHA 3QMLA 3LDNA 5AQFA 3L6QA 2V7ZA 3QFUA 4GNIA 3BK3C 1HX1A 3KC6A 4H5NA 3GL1A 5AQXA 4UAEF 2QWNA 1BUPA 5F2RA 5EY4A 3L4IA 3R2VA 5AQQA 2E88A 2MBKA 2QWPA 3C7NB 3D2EA 1QQNA 4UADE 5EVZA 5AQKA 4H5RA 5FPEA 4H5VA 5AQUA 5AQSA 2GMOA 5AQPA 1ATSA 3ATVA 5FPNA 1NGAA 4KBOA 3FZLA 5AQJA 2QWQA 2K35A 3HSCA 5AQOA 1BA1A 3L56A 4H5TA 2D56A 1NGBA 5BPLA 2KHOA 1NGFA 3LDOA 2BUPA 3QFPA 1HPMA 2JDQD 4UAFE 5BPNA 1HJOA 5AQMA 5AQRA 3LDPA 3CW4A 5BPMA 3QI7A 3A8YA 3IUCA 2QW9A 2YILA 1ATRA 1KAYA 3C7NA 1DKGD 4FL9A 3D2FB 5EXWA 4HWIA 3FZKA 3CQXA 1YUWA 1BA0A 1NGEA 5AQWA 4H5WA 1NGIA 5AQGA 3I33A 5FPDA 1QQOA 1NGJA 2MN5A 3D2EB 2E8AA 2LN8A 2QWLA 3ATUA 2QWRA 5BN9A 2YIPA 3LDLA 2E2FA 3FZMA 3SF4D 1S3XA 5F0XA 3FZHA 5AQLA 5AR0A 5BN8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L56 A;  4UAF E;  2JDQ D;  4UAD E;  2VY6 A;  3KHW A;  3KC6 A;  2GMO A;  3R2V A;  3CW4 A;  4UAE F; 
#chains in the Genus database with same CATH topology
 1B7D A;  5AQV A;  1TI5 A;  1B3C A;  1NGD A;  3FZF A;  2VY6 A;  5AQZ A;  3GDQ A;  1ZYV A;  4FSV A;  1ICA A;  3JXU A;  1ZVE A;  1JZA A;  2M8B B;  3LDQ A;  5AQN A;  1CN2 A;  2E0H A;  1NGG A;  2QXL A;  5AQH A;  3AY9 A;  1SN1 A;  3KVG A;  2QWM A;  1QQM A;  3FE1 A;  1NGC A;  4IO8 A;  5EX5 A;  1BK8 A;  1VNA A;  1DJT A;  1LQQ A;  5FPM A;  1VNB A;  1WMT A;  5F1X A;  5AQY A;  2LY6 A;  2YIO A;  1PTX A;  2BRZ A;  2QWO A;  5AQT A;  3GKU A;  1AHO A;  1I6F A;  1POI A;  3KHW A;  3D2F A;  5AQI A;  1BMR A;  1KAZ A;  1C56 A;  1KAX A;  1NRA A;  1ZVG A;  3M3Z A;  1GPS A;  1K8B A;  1NGH A;  1UGL A;  3E7U X;  2B3C A;  2LKB A;  3LDN A;  3QML A;  3L6Q A;  1LQH A;  5AQF A;  2V7Z A;  3QFU A;  4GNI A;  1LQI A;  3BK3 C;  1HX1 A;  3KC6 A;  4H5N A;  3GL1 A;  2LR3 A;  2I61 A;  5AQX A;  4UAE F;  2QWN A;  2NY8 X;  1BUP A;  3E7R L;  5F2R A;  1KV0 A;  5EY4 A;  4UJ0 A;  1WWN A;  3L4I A;  1NE5 A;  2ATB A;  2N69 A;  2E88 A;  2MBK A;  2QWP A;  3C7N B;  3D2E A;  1QQN A;  3KOZ A;  4UAD E;  5EVZ A;  2LT8 A;  2KGQ A;  4AB0 A;  1I2V A;  2YBR C;  5AQK A;  2B68 A;  1XRS B;  1C55 A;  1OZZ A;  4H5R A;  1FH3 A;  1P0A A;  5FPE A;  1JKZ A;  1ZFU A;  1MR4 A;  3KOX A;  4H5V A;  1AYJ A;  1PX9 A;  5AQU A;  5AQS A;  4CQK A;  1GPT A;  2GMO A;  2KJA A;  5AQP A;  1ATS A;  2YEO A;  3ATV A;  2LY5 A;  5FPN A;  1NGA A;  2A7T A;  3PSM A;  4KBO A;  3FZL A;  5AQJ A;  2QWQ A;  1L4V A;  1BCG A;  2K35 A;  3HSC A;  4AAZ A;  5AQO A;  1BA1 A;  2E3F A;  3L56 A;  4H5T A;  2D56 A;  1NGB A;  3KP1 A;  5BPL A;  2KHO A;  2MZ0 A;  1NGF A;  1T7E A;  5CY0 A;  2KBJ A;  1I6G A;  3LDO A;  2BUP A;  3QFP A;  1HPM A;  2JDQ D;  4UAF E;  3R2V A;  5BPN A;  1HJO A;  1N4N A;  1BRZ A;  5AQM A;  2G2K A;  5AQR A;  3LDP A;  3CW4 A;  5BPM A;  3QI7 A;  3A8Y A;  3IUC A;  2QW9 A;  2YIL A;  1ATR A;  1NH5 A;  1KAY A;  2KPY A;  3C7N A;  1DKG D;  4FL9 A;  3D2F B;  1OMY A;  4KYP A;  1JZB A;  5EXW A;  1JXC A;  4HWI A;  2LJ7 A;  3FZK A;  3CQX A;  1YUW A;  1BA0 A;  1NGE A;  2GL1 A;  5AQQ A;  1ZUT A;  2NY9 X;  5AQW A;  1WT7 A;  1ZYW A;  1SNB A;  4H5W A;  4V1D C;  1MYN A;  1NGI A;  1P00 A;  2SN3 A;  5KK4 A;  5AQG A;  4HE7 A;  1NPI A;  2E3G A;  3I33 A;  5FPD A;  3KOY A;  1SEG A;  1QQO A;  1NGJ A;  1T1T A;  1T0Z A;  2LJM A;  1NRB A;  2MN5 A;  2N2R A;  2E8A A;  2KSK A;  2LN8 A;  3D2E B;  2QWL A;  3ATU A;  3KOW A;  1T7A A;  2QWR A;  3KP0 A;  2YIP A;  5BN9 A;  2YC1 C;  1ZU3 A;  1CHZ A;  2LI7 A;  2N66 A;  4AEI A;  1I2U A;  3LDL A;  2KYQ A;  4HHF A;  2E2F A;  3FZM A;  3SF4 D;  1S3X A;  5F0X A;  1PE4 A;  1DQ7 A;  1SN4 A;  2ASC A;  2KBH A;  2KBK A;  2N2Q A;  3FZH A;  5AQL A;  1T7B A;  5AR0 A;  5BN8 A; 
#chains in the Genus database with same CATH homology
 5AQV A;  1NGD A;  3FZF A;  2VY6 A;  5AQZ A;  3GDQ A;  4FSV A;  3JXU A;  3LDQ A;  5AQN A;  5AQH A;  1NGG A;  2QXL A;  5EX5 A;  3AY9 A;  3KVG A;  2QWM A;  1QQM A;  3FE1 A;  1NGC A;  4IO8 A;  5FPM A;  5F1X A;  5AQY A;  2YIO A;  2QWO A;  5AQT A;  3KHW A;  1POI A;  5AQI A;  3D2F A;  1KAZ A;  1KAX A;  3M3Z A;  1NGH A;  3QML A;  3LDN A;  5AQF A;  3L6Q A;  2V7Z A;  3QFU A;  4GNI A;  3BK3 C;  1HX1 A;  3KC6 A;  4H5N A;  3GL1 A;  5AQX A;  4UAE F;  2QWN A;  1BUP A;  5F2R A;  5EY4 A;  3L4I A;  3R2V A;  5AQQ A;  2E88 A;  2MBK A;  2QWP A;  3C7N B;  3D2E A;  1QQN A;  4UAD E;  5EVZ A;  5AQK A;  4H5R A;  5FPE A;  4H5V A;  5AQU A;  5AQS A;  2GMO A;  5AQP A;  1ATS A;  3ATV A;  5FPN A;  1NGA A;  4KBO A;  3FZL A;  5AQJ A;  2QWQ A;  2K35 A;  3HSC A;  5AQO A;  1BA1 A;  3L56 A;  4H5T A;  2D56 A;  1NGB A;  5BPL A;  2KHO A;  1NGF A;  3LDO A;  2BUP A;  3QFP A;  1HPM A;  2JDQ D;  4UAF E;  5BPN A;  1HJO A;  5AQM A;  5AQR A;  3LDP A;  3CW4 A;  5BPM A;  3QI7 A;  3A8Y A;  3IUC A;  2QW9 A;  2YIL A;  1ATR A;  1KAY A;  3C7N A;  1DKG D;  4FL9 A;  3D2F B;  5EXW A;  4HWI A;  3FZK A;  3CQX A;  1YUW A;  1BA0 A;  1NGE A;  5AQW A;  4H5W A;  1NGI A;  5AQG A;  3I33 A;  5FPD A;  1QQO A;  1NGJ A;  2MN5 A;  3D2E B;  2E8A A;  2LN8 A;  2QWL A;  3ATU A;  2QWR A;  5BN9 A;  2YIP A;  3LDL A;  2E2F A;  3FZM A;  3SF4 D;  1S3X A;  5F0X A;  3FZH A;  5AQL A;  5AR0 A;  5BN8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...