1SN1A

Structure of scorpion neurotoxin bmk m1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
VRDAYIAKPHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PROTEIN (NEUROTOXIN BMK M1)
publication title Crystal structures of two alpha-like scorpion toxins: non-proline cis peptide bonds and implications for new binding site selectivity on the sodium channel.
pubmed doi rcsb
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1998-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1sn1A00
1WWNA 1LQQA 1GPTA 1NH5A 2LR3A 1GPSA 1JZAA 2KGQA 2E0HA 1JZBA 2N66A 1SEGA 1BCGA 1NE5A 2B68A 2E3GA 1C56A 1P0AA 1KV0A 2N2RA 4HHFA 2NY8X 2ATBA 1B3CA 1PE4A 2SN3A 1ZVEA 1FH3A 2A7TA 4KYPA 4UJ0A 5CY0A 1P00A 2KJAA 1OZZA 2N69A 1OMYA 1SN4A 1NPIA 2B3CA 5KK4A 1T7AA 2YBRC 4CQKA 1CN2A 2LT8A 1LQHA 1N4NA 2KBKA 1MR4A 1PX9A 1BMRA 1T1TA 4AEIA 2LI7A 1MYNA 1L4VA 2GL1A 2I61A 2N2QA 2ASCA 2KPYA 1ICAA 2YEOA 1T7BA 1WT7A 4AB0A 1I2VA 3PSMA 1VNBA 2NY9X 1I6FA 2LY5A 2MZ0A 3E7RL 1CHZA 1NRBA 1WMTA 2LJ7A 1SNBA 1ZYWA 2YC1C 2KBHA 1NRAA 4V1DC 1ZU3A 1B7DA 1AHOA 2LKBA 1JKZA 1ZFUA 4AAZA 1ZVGA 4HE7A 1TI5A 2M8BB 1C55A 2E3FA 1BRZA 1DJTA 1JXCA 1ZYVA 1I6GA 1VNAA 3E7UX 1LQIA 2LJMA 1ZUTA 1T7EA 1DQ7A 1PTXA 1BK8A 1T0ZA 1I2UA 2KYQA 1AYJA 2LY6A 2KSKA 1SN1A 2BRZA 2KBJA
chains in the Genus database with same CATH superfamily
3GL1A 1WWNA 3L56A 4H5TA 3QI7A 1LQQA 2YILA 5AQJA 1GPTA 5BN8A 1NH5A 1ATSA 2LR3A 1GPSA 1ATRA 1JZAA 2KGQA 2E0HA 1JZBA 2N66A 1KAZA 1SEGA 3KP0A 5AQSA 1BCGA 1NE5A 2B68A 1UGLA 2E3GA 1C56A 1P0AA 4UAFE 1KV0A 3C7NA 3D2EA 3GDQA 1BUPA 2E8AA 1YUWA 2N2RA 2ATBA 2NY8X 1PE4A 2SN3A 3QFPA 1ZVEA 4HHFA 3SF4D 5F1XA 3LDNA 2A7TA 1FH3A 5AQGA 4KYPA 4UJ0A 5CY0A 5FPEA 5AQPA 1P00A 2QWLA 2KJAA 5AQTA 1OZZA 2N69A 4H5NA 1OMYA 1SN4A 1NGBA 2D56A 3KP1A 5FPMA 5AR0A 1NPIA 3D2FB 5FPNA 2B3CA 3L4IA 3LDPA 1NGFA 4H5VA 5KK4A 3QFUA 1T7AA 2YBRC 4FL9A 2YIPA 5BPNA 2KHOA 4H5RA 4CQKA 3IUCA 1CN2A 5AQQA 5AQVA 1HX1A 2LT8A 1LQHA 1N4NA 1QQMA 2KBKA 2VY6A 1MR4A 1NGHA 3GKUA 1HPMA 1PX9A 5AQIA 1BMRA 3A8YA 1T1TA 2E88A 1S3XA 3LDQA 1QQNA 5AQXA 2LI7A 5AQHA 4AEIA 1MYNA 5BN9A 5EX5A 3R2VA 2QWNA 2QXLA 1L4VA 2K35A 2GL1A 3LDLA 3JXUA 2GMOA 2I61A 2N2QA 2ASCA 2KPYA 5AQRA 5BPLA 3AY9A 3KOXA 4KBOA 1ICAA 1K8BA 2MN5A 2YEOA 1T7BA 4UADE 1NGJA 1WT7A 4AB0A 1NGAA 2JDQD 1I2VA 3PSMA 1VNBA 2NY9X 2LY5A 3L6QA 3CW4A 2E2FA 1B3CA 2QWPA 2MZ0A 3FZHA 3E7RL 4HWIA 1CHZA 1NRBA 1WMTA 3ATVA 5EXWA 2LJ7A 1SNBA 5BPMA 1ZYWA 5AQFA 2YC1C 2KBHA 3C7NB 3D2EB 1NRAA 3I33A 3KOZA 3QMLA 1ZU3A 2MBKA 4V1DC 2QWRA 1B7DA 1AHOA 2LKBA 5AQWA 5F2RA 5AQMA 2QW9A 1JKZA 1ZFUA 5AQNA 4AAZA 1ZVGA 3D2FA 4HE7A 1NGGA 3ATUA 1TI5A 2QWQA 1NGCA 2M8BB 1XRSB 1C55A 5AQLA 1NGDA 2E3FA 2YIOA 3KHWA 5AQYA 3FZLA 1BRZA 1DJTA 1KAXA 2QWOA 3FE1A 1NGIA 1JXCA 5AQUA 1ZYVA 1I6GA 3FZKA 4GNIA 3KVGA 3LDOA 3BK3C 1VNAA 3E7UX 1HJOA 3KOYA 1LQIA 2G2KA 2LJMA 2KBJA 3CQXA 1ZUTA 1T7EA 2BUPA 3FZFA 5EVZA 1DKGD 1KAYA 5F0XA 2LN8A 3M3ZA 4IO8A 1DQ7A 1PTXA 5AQZA 1BK8A 1T0ZA 4FSVA 1QQOA 5EY4A 1POIA 2V7ZA 3FZMA 3KOWA 1I2UA 1NGEA 2KYQA 1AYJA 2QWMA 3KC6A 4H5WA 5AQKA 1BA1A 2LY6A 1BA0A 1SN1A 2KSKA 4UAEF 5AQOA 5FPDA 2BRZA 1I6FA 3HSCA
chains in the Genus database with same CATH topology
1WWNA 1LQQA 1GPTA 1NH5A 2LR3A 1GPSA 1JZAA 2KGQA 2E0HA 1JZBA 2N66A 1SEGA 1BCGA 1NE5A 2B68A 2E3GA 1C56A 1P0AA 1KV0A 2N2RA 4HHFA 2NY8X 2ATBA 1B3CA 1PE4A 2SN3A 1ZVEA 1FH3A 2A7TA 4KYPA 4UJ0A 5CY0A 1P00A 2KJAA 1OZZA 2N69A 1OMYA 1SN4A 1NPIA 2B3CA 5KK4A 1T7AA 2YBRC 4CQKA 1CN2A 2LT8A 1LQHA 1N4NA 2KBKA 1MR4A 1PX9A 1BMRA 1T1TA 4AEIA 2LI7A 1MYNA 1L4VA 2GL1A 2I61A 2N2QA 2ASCA 2KPYA 1ICAA 2YEOA 1T7BA 1WT7A 4AB0A 1I2VA 3PSMA 1VNBA 2NY9X 1I6FA 2LY5A 2MZ0A 3E7RL 1CHZA 1NRBA 1WMTA 2LJ7A 1SNBA 1ZYWA 2YC1C 2KBHA 1NRAA 4V1DC 1ZU3A 1B7DA 1AHOA 2LKBA 1JKZA 1ZFUA 4AAZA 1ZVGA 4HE7A 1TI5A 2M8BB 1C55A 2E3FA 1BRZA 1DJTA 1JXCA 1ZYVA 1I6GA 1VNAA 3E7UX 1LQIA 2LJMA 1ZUTA 1T7EA 1DQ7A 1PTXA 1BK8A 1T0ZA 1I2UA 2KYQA 1AYJA 2LY6A 2KSKA 1SN1A 2BRZA 2KBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWN A;  1LQQ A;  1GPT A;  1NH5 A;  2LR3 A;  1GPS A;  1JZA A;  2KGQ A;  2E0H A;  1JZB A;  2N66 A;  1SEG A;  1BCG A;  1NE5 A;  2B68 A;  2E3G A;  1C56 A;  1P0A A;  1KV0 A;  2N2R A;  4HHF A;  2NY8 X;  2ATB A;  1B3C A;  1PE4 A;  2SN3 A;  1ZVE A;  1FH3 A;  2A7T A;  4KYP A;  4UJ0 A;  5CY0 A;  1P00 A;  2KJA A;  1OZZ A;  2N69 A;  1OMY A;  1SN4 A;  1NPI A;  2B3C A;  5KK4 A;  1T7A A;  2YBR C;  4CQK A;  1CN2 A;  2LT8 A;  1LQH A;  1N4N A;  2KBK A;  1MR4 A;  1PX9 A;  1BMR A;  1T1T A;  4AEI A;  2LI7 A;  1MYN A;  1L4V A;  2GL1 A;  2I61 A;  2N2Q A;  2ASC A;  2KPY A;  1ICA A;  2YEO A;  1T7B A;  1WT7 A;  4AB0 A;  1I2V A;  3PSM A;  1VNB A;  2NY9 X;  1I6F A;  2LY5 A;  2MZ0 A;  3E7R L;  1CHZ A;  1NRB A;  1WMT A;  2LJ7 A;  1SNB A;  1ZYW A;  2YC1 C;  2KBH A;  1NRA A;  4V1D C;  1ZU3 A;  1B7D A;  1AHO A;  2LKB A;  1JKZ A;  1ZFU A;  4AAZ A;  1ZVG A;  4HE7 A;  1TI5 A;  2M8B B;  1C55 A;  2E3F A;  1BRZ A;  1DJT A;  1JXC A;  1ZYV A;  1I6G A;  1VNA A;  3E7U X;  1LQI A;  2LJM A;  1ZUT A;  1T7E A;  1DQ7 A;  1PTX A;  1BK8 A;  1T0Z A;  1I2U A;  2KYQ A;  1AYJ A;  2LY6 A;  2KSK A;  1SN1 A;  2BRZ A;  2KBJ A; 
#chains in the Genus database with same CATH topology
 3GL1 A;  1WWN A;  3L56 A;  4H5T A;  3QI7 A;  1LQQ A;  2YIL A;  5AQJ A;  1GPT A;  5BN8 A;  1NH5 A;  1ATS A;  2LR3 A;  1GPS A;  1ATR A;  1JZA A;  2KGQ A;  2E0H A;  1JZB A;  2N66 A;  1KAZ A;  1SEG A;  3KP0 A;  5AQS A;  1BCG A;  1NE5 A;  2B68 A;  1UGL A;  2E3G A;  1C56 A;  1P0A A;  4UAF E;  1KV0 A;  3C7N A;  3D2E A;  3GDQ A;  1BUP A;  2E8A A;  1YUW A;  2N2R A;  2ATB A;  2NY8 X;  1PE4 A;  2SN3 A;  3QFP A;  1ZVE A;  4HHF A;  3SF4 D;  5F1X A;  3LDN A;  2A7T A;  1FH3 A;  5AQG A;  4KYP A;  4UJ0 A;  5CY0 A;  5FPE A;  5AQP A;  1P00 A;  2QWL A;  2KJA A;  5AQT A;  1OZZ A;  2N69 A;  4H5N A;  1OMY A;  1SN4 A;  1NGB A;  2D56 A;  3KP1 A;  5FPM A;  5AR0 A;  1NPI A;  3D2F B;  5FPN A;  2B3C A;  3L4I A;  3LDP A;  1NGF A;  4H5V A;  5KK4 A;  3QFU A;  1T7A A;  2YBR C;  4FL9 A;  2YIP A;  5BPN A;  2KHO A;  4H5R A;  4CQK A;  3IUC A;  1CN2 A;  5AQQ A;  5AQV A;  1HX1 A;  2LT8 A;  1LQH A;  1N4N A;  1QQM A;  2KBK A;  2VY6 A;  1MR4 A;  1NGH A;  3GKU A;  1HPM A;  1PX9 A;  5AQI A;  1BMR A;  3A8Y A;  1T1T A;  2E88 A;  1S3X A;  3LDQ A;  1QQN A;  5AQX A;  2LI7 A;  5AQH A;  4AEI A;  1MYN A;  5BN9 A;  5EX5 A;  3R2V A;  2QWN A;  2QXL A;  1L4V A;  2K35 A;  2GL1 A;  3LDL A;  3JXU A;  2GMO A;  2I61 A;  2N2Q A;  2ASC A;  2KPY A;  5AQR A;  5BPL A;  3AY9 A;  3KOX A;  4KBO A;  1ICA A;  1K8B A;  2MN5 A;  2YEO A;  1T7B A;  4UAD E;  1NGJ A;  1WT7 A;  4AB0 A;  1NGA A;  2JDQ D;  1I2V A;  3PSM A;  1VNB A;  2NY9 X;  2LY5 A;  3L6Q A;  3CW4 A;  2E2F A;  1B3C A;  2QWP A;  2MZ0 A;  3FZH A;  3E7R L;  4HWI A;  1CHZ A;  1NRB A;  1WMT A;  3ATV A;  5EXW A;  2LJ7 A;  1SNB A;  5BPM A;  1ZYW A;  5AQF A;  2YC1 C;  2KBH A;  3C7N B;  3D2E B;  1NRA A;  3I33 A;  3KOZ A;  3QML A;  1ZU3 A;  2MBK A;  4V1D C;  2QWR A;  1B7D A;  1AHO A;  2LKB A;  5AQW A;  5F2R A;  5AQM A;  2QW9 A;  1JKZ A;  1ZFU A;  5AQN A;  4AAZ A;  1ZVG A;  3D2F A;  4HE7 A;  1NGG A;  3ATU A;  1TI5 A;  2QWQ A;  1NGC A;  2M8B B;  1XRS B;  1C55 A;  5AQL A;  1NGD A;  2E3F A;  2YIO A;  3KHW A;  5AQY A;  3FZL A;  1BRZ A;  1DJT A;  1KAX A;  2QWO A;  3FE1 A;  1NGI A;  1JXC A;  5AQU A;  1ZYV A;  1I6G A;  3FZK A;  4GNI A;  3KVG A;  3LDO A;  3BK3 C;  1VNA A;  3E7U X;  1HJO A;  3KOY A;  1LQI A;  2G2K A;  2LJM A;  2KBJ A;  3CQX A;  1ZUT A;  1T7E A;  2BUP A;  3FZF A;  5EVZ A;  1DKG D;  1KAY A;  5F0X A;  2LN8 A;  3M3Z A;  4IO8 A;  1DQ7 A;  1PTX A;  5AQZ A;  1BK8 A;  1T0Z A;  4FSV A;  1QQO A;  5EY4 A;  1POI A;  2V7Z A;  3FZM A;  3KOW A;  1I2U A;  1NGE A;  2KYQ A;  1AYJ A;  2QWM A;  3KC6 A;  4H5W A;  5AQK A;  1BA1 A;  2LY6 A;  1BA0 A;  1SN1 A;  2KSK A;  4UAE F;  5AQO A;  5FPD A;  2BRZ A;  1I6F A;  3HSC A; 
#chains in the Genus database with same CATH homology
 1WWN A;  1LQQ A;  1GPT A;  1NH5 A;  2LR3 A;  1GPS A;  1JZA A;  2KGQ A;  2E0H A;  1JZB A;  2N66 A;  1SEG A;  1BCG A;  1NE5 A;  2B68 A;  2E3G A;  1C56 A;  1P0A A;  1KV0 A;  2N2R A;  4HHF A;  2NY8 X;  2ATB A;  1B3C A;  1PE4 A;  2SN3 A;  1ZVE A;  1FH3 A;  2A7T A;  4KYP A;  4UJ0 A;  5CY0 A;  1P00 A;  2KJA A;  1OZZ A;  2N69 A;  1OMY A;  1SN4 A;  1NPI A;  2B3C A;  5KK4 A;  1T7A A;  2YBR C;  4CQK A;  1CN2 A;  2LT8 A;  1LQH A;  1N4N A;  2KBK A;  1MR4 A;  1PX9 A;  1BMR A;  1T1T A;  4AEI A;  2LI7 A;  1MYN A;  1L4V A;  2GL1 A;  2I61 A;  2N2Q A;  2ASC A;  2KPY A;  1ICA A;  2YEO A;  1T7B A;  1WT7 A;  4AB0 A;  1I2V A;  3PSM A;  1VNB A;  2NY9 X;  1I6F A;  2LY5 A;  2MZ0 A;  3E7R L;  1CHZ A;  1NRB A;  1WMT A;  2LJ7 A;  1SNB A;  1ZYW A;  2YC1 C;  2KBH A;  1NRA A;  4V1D C;  1ZU3 A;  1B7D A;  1AHO A;  2LKB A;  1JKZ A;  1ZFU A;  4AAZ A;  1ZVG A;  4HE7 A;  1TI5 A;  2M8B B;  1C55 A;  2E3F A;  1BRZ A;  1DJT A;  1JXC A;  1ZYV A;  1I6G A;  1VNA A;  3E7U X;  1LQI A;  2LJM A;  1ZUT A;  1T7E A;  1DQ7 A;  1PTX A;  1BK8 A;  1T0Z A;  1I2U A;  2KYQ A;  1AYJ A;  2LY6 A;  2KSK A;  1SN1 A;  2BRZ A;  2KBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...