1GPSA

Solution structure of gamma 1-h and gamma 1-p thionins from barley and wheat endosperm determined by 1h-nmr: a structural motif common to toxic arthropod proteins
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
KICRRRSAGFKGPCMSNKNCAQVCQQEGWGGGNCDGPFRRCKCIRQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant toxin
molecule keywords GAMMA-1-P THIONIN
publication title Solution structure of gamma 1-H and gamma 1-P thionins from barley and wheat endosperm determined by 1H-NMR: a structural motif common to toxic arthropod proteins.
pubmed doi rcsb
source organism Triticum turgidum
total genus 10
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 1992-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1gpsA00
2SN3A 1I6GA 2E3FA 1BCGA 2YC1C 3E7UX 2KGQA 1AYJA 2LT8A 2MZ0A 4KYPA 1BRZA 1I6FA 1NPIA 1ZVGA 1P0AA 4AAZA 1NH5A 1NE5A 2KYQA 1C55A 1I2UA 2LY5A 4CQKA 2KJAA 1JZAA 2N66A 1DJTA 2YEOA 2N2QA 2LJ7A 1LQIA 1WT7A 1PX9A 2KSKA 5KK4A 2ASCA 2N69A 3PSMA 1MR4A 2KPYA 1FH3A 4AB0A 2A7TA 2KBKA 2B68A 1B3CA 2NY9X 1NRBA 3E7RL 1WMTA 1KV0A 2I61A 1OZZA 4UJ0A 1B7DA 2GL1A 1ZUTA 2LJMA 1PTXA 2E3GA 2LKBA 1T7BA 1I2VA 1LQHA 2M8BB 1T0ZA 1ZYWA 1C56A 1JZBA 1P00A 2NY8X 2ATBA 2E0HA 1CHZA 1NRAA 1SN4A 2LR3A 1MYNA 1WWNA 4HHFA 1ZFUA 2N2RA 1L4VA 1SNBA 1OMYA 1ZYVA 2LI7A 1LQQA 1SN1A 1GPTA 1BMRA 1PE4A 1BK8A 4V1DC 1T7EA 1T1TA 1JKZA 4HE7A 1ZU3A 1DQ7A 2BRZA 2LY6A 2YBRC 1GPSA 1TI5A 1ICAA 1VNAA 1SEGA 2B3CA 2KBHA 1ZVEA 1CN2A 1N4NA 4AEIA 1JXCA 2KBJA 1VNBA 1T7AA 5CY0A 1AHOA
chains in the Genus database with same CATH superfamily
3HSCA 1NGFA 1BUPA 2SN3A 1I6GA 1XRSB 2E3FA 3QFPA 1BCGA 1NGGA 1NGDA 2YC1C 3FE1A 3E7UX 2KGQA 1AYJA 2LT8A 3L6QA 2MZ0A 4H5RA 3D2FA 4H5TA 3FZLA 3GKUA 2MN5A 1QQNA 1I6FA 1QQOA 4KYPA 1BRZA 2QWLA 4HWIA 1NPIA 3QFUA 1ZVGA 3IUCA 3D2EA 5AQZA 5AQUA 1P0AA 1ATRA 5F1XA 4AAZA 5BPNA 1NH5A 1NE5A 3LDOA 2KYQA 3A8YA 2E8AA 1C55A 4IO8A 1I2UA 2LY5A 4CQKA 1YUWA 2KJAA 5AQIA 1JZAA 5AQRA 2QW9A 2N66A 5AQKA 2D56A 1NGEA 1DJTA 2YEOA 2K35A 3FZKA 3GL1A 3LDPA 5AQNA 2N2QA 5EY4A 5F0XA 2LJ7A 5AQLA 1LQIA 3FZMA 3KC6A 1NGBA 1WT7A 3KOWA 5AQOA 5F2RA 1PX9A 2QWOA 2E88A 2KSKA 5KK4A 1QQMA 2ASCA 2N69A 4H5WA 3PSMA 1NGIA 1MR4A 3KP0A 4UAEF 3QI7A 5AQTA 3KOYA 1DKGD 2KPYA 2QWRA 2JDQD 2QWMA 4AB0A 1FH3A 2A7TA 5BPLA 2KBKA 2B68A 1B3CA 3R2VA 3KVGA 2NY9X 1NRBA 4GNIA 3E7RL 1WMTA 3C7NB 3FZHA 1KAYA 2QWQA 1NGJA 2VY6A 5AQHA 1KV0A 2V7ZA 2I61A 1BA0A 3AY9A 2MBKA 1OZZA 5AQVA 2YIOA 3LDNA 4UJ0A 2QWNA 3QMLA 1B7DA 1NGHA 2GL1A 1ZUTA 2LJMA 3ATVA 3D2FB 1PTXA 3L4IA 4H5NA 2E3GA 4H5VA 2LKBA 1T7BA 3JXUA 5AQWA 1I2VA 1S3XA 3LDLA 1LQHA 2M8BB 3FZFA 1T0ZA 1ZYWA 3D2EB 1C56A 1JZBA 5AQYA 1ATSA 1P00A 2NY8X 2ATBA 1BA1A 2YILA 4UADE 1KAZA 2E0HA 1CHZA 5BN8A 5BPMA 1NRAA 2E2FA 2G2KA 3KOXA 1KAXA 5EX5A 1SN4A 2LR3A 5AR0A 5AQPA 1MYNA 1WWNA 1HJOA 5EVZA 4HHFA 1ZFUA 2N2RA 2YIPA 5BN9A 1L4VA 5FPEA 1SNBA 2GMOA 1OMYA 1ZYVA 3M3ZA 2LI7A 1LQQA 3KP1A 1SN1A 3CW4A 1GPTA 5FPMA 4FL9A 2KHOA 1BMRA 3KOZA 1PE4A 3L56A 4V1DC 1T7EA 4UAFE 1T1TA 1BK8A 1JKZA 2QWPA 1K8BA 4HE7A 5FPDA 1ZU3A 1DQ7A 2BRZA 3KHWA 2LY6A 3I33A 3GDQA 5AQXA 5EXWA 2QXLA 5AQMA 3ATUA 5FPNA 2YBRC 5AQJA 1GPSA 1POIA 1HPMA 1TI5A 4KBOA 5AQGA 5AQFA 1HX1A 3LDQA 5AQSA 3CQXA 3BK3C 1ICAA 1VNAA 1NGAA 2LN8A 1SEGA 2B3CA 2KBHA 1ZVEA 1CN2A 1N4NA 2BUPA 4FSVA 4AEIA 1JXCA 2KBJA 1NGCA 3C7NA 1VNBA 1UGLA 5AQQA 1T7AA 3SF4D 5CY0A 1AHOA
chains in the Genus database with same CATH topology
2SN3A 1I6GA 2E3FA 1BCGA 2YC1C 3E7UX 2KGQA 1AYJA 2LT8A 2MZ0A 4KYPA 1BRZA 1I6FA 1NPIA 1ZVGA 1P0AA 4AAZA 1NH5A 1NE5A 2KYQA 1C55A 1I2UA 2LY5A 4CQKA 2KJAA 1JZAA 2N66A 1DJTA 2YEOA 2N2QA 2LJ7A 1LQIA 1WT7A 1PX9A 2KSKA 5KK4A 2ASCA 2N69A 3PSMA 1MR4A 2KPYA 1FH3A 4AB0A 2A7TA 2KBKA 2B68A 1B3CA 2NY9X 1NRBA 3E7RL 1WMTA 1KV0A 2I61A 1OZZA 4UJ0A 1B7DA 2GL1A 1ZUTA 2LJMA 1PTXA 2E3GA 2LKBA 1T7BA 1I2VA 1LQHA 2M8BB 1T0ZA 1ZYWA 1C56A 1JZBA 1P00A 2NY8X 2ATBA 2E0HA 1CHZA 1NRAA 1SN4A 2LR3A 1MYNA 1WWNA 4HHFA 1ZFUA 2N2RA 1L4VA 1SNBA 1OMYA 1ZYVA 2LI7A 1LQQA 1SN1A 1GPTA 1BMRA 1PE4A 1BK8A 4V1DC 1T7EA 1T1TA 1JKZA 4HE7A 1ZU3A 1DQ7A 2BRZA 2LY6A 2YBRC 1GPSA 1TI5A 1ICAA 1VNAA 1SEGA 2B3CA 2KBHA 1ZVEA 1CN2A 1N4NA 4AEIA 1JXCA 2KBJA 1VNBA 1T7AA 5CY0A 1AHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SN3 A;  1I6G A;  2E3F A;  1BCG A;  2YC1 C;  3E7U X;  2KGQ A;  1AYJ A;  2LT8 A;  2MZ0 A;  4KYP A;  1BRZ A;  1I6F A;  1NPI A;  1ZVG A;  1P0A A;  4AAZ A;  1NH5 A;  1NE5 A;  2KYQ A;  1C55 A;  1I2U A;  2LY5 A;  4CQK A;  2KJA A;  1JZA A;  2N66 A;  1DJT A;  2YEO A;  2N2Q A;  2LJ7 A;  1LQI A;  1WT7 A;  1PX9 A;  2KSK A;  5KK4 A;  2ASC A;  2N69 A;  3PSM A;  1MR4 A;  2KPY A;  1FH3 A;  4AB0 A;  2A7T A;  2KBK A;  2B68 A;  1B3C A;  2NY9 X;  1NRB A;  3E7R L;  1WMT A;  1KV0 A;  2I61 A;  1OZZ A;  4UJ0 A;  1B7D A;  2GL1 A;  1ZUT A;  2LJM A;  1PTX A;  2E3G A;  2LKB A;  1T7B A;  1I2V A;  1LQH A;  2M8B B;  1T0Z A;  1ZYW A;  1C56 A;  1JZB A;  1P00 A;  2NY8 X;  2ATB A;  2E0H A;  1CHZ A;  1NRA A;  1SN4 A;  2LR3 A;  1MYN A;  1WWN A;  4HHF A;  1ZFU A;  2N2R A;  1L4V A;  1SNB A;  1OMY A;  1ZYV A;  2LI7 A;  1LQQ A;  1SN1 A;  1GPT A;  1BMR A;  1PE4 A;  1BK8 A;  4V1D C;  1T7E A;  1T1T A;  1JKZ A;  4HE7 A;  1ZU3 A;  1DQ7 A;  2BRZ A;  2LY6 A;  2YBR C;  1GPS A;  1TI5 A;  1ICA A;  1VNA A;  1SEG A;  2B3C A;  2KBH A;  1ZVE A;  1CN2 A;  1N4N A;  4AEI A;  1JXC A;  2KBJ A;  1VNB A;  1T7A A;  5CY0 A;  1AHO A; 
#chains in the Genus database with same CATH topology
 3HSC A;  1NGF A;  1BUP A;  2SN3 A;  1I6G A;  1XRS B;  2E3F A;  3QFP A;  1BCG A;  1NGG A;  1NGD A;  2YC1 C;  3FE1 A;  3E7U X;  2KGQ A;  1AYJ A;  2LT8 A;  3L6Q A;  2MZ0 A;  4H5R A;  3D2F A;  4H5T A;  3FZL A;  3GKU A;  2MN5 A;  1QQN A;  1I6F A;  1QQO A;  4KYP A;  1BRZ A;  2QWL A;  4HWI A;  1NPI A;  3QFU A;  1ZVG A;  3IUC A;  3D2E A;  5AQZ A;  5AQU A;  1P0A A;  1ATR A;  5F1X A;  4AAZ A;  5BPN A;  1NH5 A;  1NE5 A;  3LDO A;  2KYQ A;  3A8Y A;  2E8A A;  1C55 A;  4IO8 A;  1I2U A;  2LY5 A;  4CQK A;  1YUW A;  2KJA A;  5AQI A;  1JZA A;  5AQR A;  2QW9 A;  2N66 A;  5AQK A;  2D56 A;  1NGE A;  1DJT A;  2YEO A;  2K35 A;  3FZK A;  3GL1 A;  3LDP A;  5AQN A;  2N2Q A;  5EY4 A;  5F0X A;  2LJ7 A;  5AQL A;  1LQI A;  3FZM A;  3KC6 A;  1NGB A;  1WT7 A;  3KOW A;  5AQO A;  5F2R A;  1PX9 A;  2QWO A;  2E88 A;  2KSK A;  5KK4 A;  1QQM A;  2ASC A;  2N69 A;  4H5W A;  3PSM A;  1NGI A;  1MR4 A;  3KP0 A;  4UAE F;  3QI7 A;  5AQT A;  3KOY A;  1DKG D;  2KPY A;  2QWR A;  2JDQ D;  2QWM A;  4AB0 A;  1FH3 A;  2A7T A;  5BPL A;  2KBK A;  2B68 A;  1B3C A;  3R2V A;  3KVG A;  2NY9 X;  1NRB A;  4GNI A;  3E7R L;  1WMT A;  3C7N B;  3FZH A;  1KAY A;  2QWQ A;  1NGJ A;  2VY6 A;  5AQH A;  1KV0 A;  2V7Z A;  2I61 A;  1BA0 A;  3AY9 A;  2MBK A;  1OZZ A;  5AQV A;  2YIO A;  3LDN A;  4UJ0 A;  2QWN A;  3QML A;  1B7D A;  1NGH A;  2GL1 A;  1ZUT A;  2LJM A;  3ATV A;  3D2F B;  1PTX A;  3L4I A;  4H5N A;  2E3G A;  4H5V A;  2LKB A;  1T7B A;  3JXU A;  5AQW A;  1I2V A;  1S3X A;  3LDL A;  1LQH A;  2M8B B;  3FZF A;  1T0Z A;  1ZYW A;  3D2E B;  1C56 A;  1JZB A;  5AQY A;  1ATS A;  1P00 A;  2NY8 X;  2ATB A;  1BA1 A;  2YIL A;  4UAD E;  1KAZ A;  2E0H A;  1CHZ A;  5BN8 A;  5BPM A;  1NRA A;  2E2F A;  2G2K A;  3KOX A;  1KAX A;  5EX5 A;  1SN4 A;  2LR3 A;  5AR0 A;  5AQP A;  1MYN A;  1WWN A;  1HJO A;  5EVZ A;  4HHF A;  1ZFU A;  2N2R A;  2YIP A;  5BN9 A;  1L4V A;  5FPE A;  1SNB A;  2GMO A;  1OMY A;  1ZYV A;  3M3Z A;  2LI7 A;  1LQQ A;  3KP1 A;  1SN1 A;  3CW4 A;  1GPT A;  5FPM A;  4FL9 A;  2KHO A;  1BMR A;  3KOZ A;  1PE4 A;  3L56 A;  4V1D C;  1T7E A;  4UAF E;  1T1T A;  1BK8 A;  1JKZ A;  2QWP A;  1K8B A;  4HE7 A;  5FPD A;  1ZU3 A;  1DQ7 A;  2BRZ A;  3KHW A;  2LY6 A;  3I33 A;  3GDQ A;  5AQX A;  5EXW A;  2QXL A;  5AQM A;  3ATU A;  5FPN A;  2YBR C;  5AQJ A;  1GPS A;  1POI A;  1HPM A;  1TI5 A;  4KBO A;  5AQG A;  5AQF A;  1HX1 A;  3LDQ A;  5AQS A;  3CQX A;  3BK3 C;  1ICA A;  1VNA A;  1NGA A;  2LN8 A;  1SEG A;  2B3C A;  2KBH A;  1ZVE A;  1CN2 A;  1N4N A;  2BUP A;  4FSV A;  4AEI A;  1JXC A;  2KBJ A;  1NGC A;  3C7N A;  1VNB A;  1UGL A;  5AQQ A;  1T7A A;  3SF4 D;  5CY0 A;  1AHO A; 
#chains in the Genus database with same CATH homology
 2SN3 A;  1I6G A;  2E3F A;  1BCG A;  2YC1 C;  3E7U X;  2KGQ A;  1AYJ A;  2LT8 A;  2MZ0 A;  4KYP A;  1BRZ A;  1I6F A;  1NPI A;  1ZVG A;  1P0A A;  4AAZ A;  1NH5 A;  1NE5 A;  2KYQ A;  1C55 A;  1I2U A;  2LY5 A;  4CQK A;  2KJA A;  1JZA A;  2N66 A;  1DJT A;  2YEO A;  2N2Q A;  2LJ7 A;  1LQI A;  1WT7 A;  1PX9 A;  2KSK A;  5KK4 A;  2ASC A;  2N69 A;  3PSM A;  1MR4 A;  2KPY A;  1FH3 A;  4AB0 A;  2A7T A;  2KBK A;  2B68 A;  1B3C A;  2NY9 X;  1NRB A;  3E7R L;  1WMT A;  1KV0 A;  2I61 A;  1OZZ A;  4UJ0 A;  1B7D A;  2GL1 A;  1ZUT A;  2LJM A;  1PTX A;  2E3G A;  2LKB A;  1T7B A;  1I2V A;  1LQH A;  2M8B B;  1T0Z A;  1ZYW A;  1C56 A;  1JZB A;  1P00 A;  2NY8 X;  2ATB A;  2E0H A;  1CHZ A;  1NRA A;  1SN4 A;  2LR3 A;  1MYN A;  1WWN A;  4HHF A;  1ZFU A;  2N2R A;  1L4V A;  1SNB A;  1OMY A;  1ZYV A;  2LI7 A;  1LQQ A;  1SN1 A;  1GPT A;  1BMR A;  1PE4 A;  1BK8 A;  4V1D C;  1T7E A;  1T1T A;  1JKZ A;  4HE7 A;  1ZU3 A;  1DQ7 A;  2BRZ A;  2LY6 A;  2YBR C;  1GPS A;  1TI5 A;  1ICA A;  1VNA A;  1SEG A;  2B3C A;  2KBH A;  1ZVE A;  1CN2 A;  1N4N A;  4AEI A;  1JXC A;  2KBJ A;  1VNB A;  1T7A A;  5CY0 A;  1AHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...