2LJMA

Solution structure of cssii
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
82
structure length
82
Chain Sequence
MRGSHHHHHHGSIEGRKEGYLVSKSTGCKYECLKLGDNDYCLRECKQQYGKSSGGYCYAFACWCTHLYEQAVVWPLPNKTCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-mammal toxin Css2
publication title Solution structure of native and recombinant expressed toxin CssII from the venom of the scorpion Centruroides suffusus suffusus, and their effects on Nav1.5 Sodium channels.
pubmed doi rcsb
molecule tags Toxin
total genus 5
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2ljmA01
2N69A 5KK4A 1DQ7A 4AB0A 1T7AA 1CN2A 1T0ZA 2LKBA 2NY9X 4HE7A 2M8BB 3PSMA 2LY5A 1OMYA 2N2QA 2E3FA 2E0HA 2ASCA 1NH5A 1BRZA 1LQIA 3E7UX 1ZYVA 2I61A 2KPYA 2LJ7A 4CQKA 1I2VA 1ZUTA 1ZU3A 1BMRA 2N66A 1P0AA 4HHFA 1CHZA 1SN1A 4AAZA 1PX9A 1ZYWA 1NE5A 1LQHA 2B3CA 1L4VA 1WMTA 1WWNA 2LR3A 2SN3A 2ATBA 1JZAA 1TI5A 1N4NA 1NRBA 1ZVEA 2LI7A 4KYPA 1VNBA 2KBJA 1SNBA 2KBKA 2GL1A 1I2UA 1BCGA 2N2RA 1BK8A 2KGQA 2YC1C 1C55A 1GPTA 2YBRC 1T7BA 2YEOA 1PTXA 2A7TA 5CY0A 1NRAA 2B68A 1ZFUA 1JKZA 1B7DA 1AHOA 1KV0A 1T7EA 2LY6A 1ZVGA 1VNAA 1I6GA 1C56A 4V1DC 1AYJA 2LT8A 2KYQA 3E7RL 1OZZA 1FH3A 1ICAA 2KBHA 2E3GA 2NY8X 1MR4A 2LJMA 1P00A 1MYNA 2KSKA 1WT7A 1B3CA 1PE4A 1DJTA 1JXCA 1GPSA 1LQQA 4AEIA 1SEGA 2BRZA 4UJ0A 2MZ0A 1JZBA 1SN4A 1NPIA 2KJAA 1I6FA 1T1TA
chains in the Genus database with same CATH superfamily
1NGIA 1YUWA 2N69A 5AQGA 5KK4A 2E2FA 1POIA 5EY4A 1DQ7A 4AB0A 1T7AA 2E88A 3R2VA 2QWNA 3ATVA 1DKGD 1T0ZA 2LKBA 1CN2A 3CQXA 2NY9X 4HE7A 1ATSA 2M8BB 2QXLA 3FZLA 3JXUA 2LY5A 3PSMA 1OMYA 5AQUA 2N2QA 3SF4D 3FE1A 2E3FA 1S3XA 3I33A 2YIOA 2E0HA 3LDQA 5EVZA 2ASCA 3HSCA 3D2EA 2QWRA 1HPMA 1NH5A 5AQLA 1BRZA 2KHOA 1KAYA 5F0XA 5AQHA 3A8YA 1LQIA 3FZKA 3D2FB 3E7UX 5AQWA 4KBOA 5BPMA 1NGCA 1ZYVA 2I61A 2KPYA 4H5WA 4H5VA 2LJ7A 2D56A 1NGEA 3KP0A 5FPDA 4CQKA 1XRSB 1I2VA 1NGBA 1ZUTA 1ZU3A 5FPMA 1BMRA 2N66A 5AQJA 1P0AA 2QW9A 3QFUA 4HHFA 1CHZA 1SN1A 4AAZA 1PX9A 1QQNA 3KOXA 5AQXA 1ZYWA 1NE5A 2QWOA 2YILA 3KP1A 3FZMA 2E8AA 1LQHA 3L4IA 2BUPA 2B3CA 1L4VA 1WMTA 1WWNA 2LR3A 2SN3A 5AQKA 3D2FA 3KC6A 1KAZA 2ATBA 1JZAA 5AQOA 1TI5A 3LDLA 3M3ZA 4UADE 5F1XA 2MBKA 3BK3C 3KOWA 1N4NA 1NRBA 1ZVEA 2LI7A 5F2RA 1QQMA 2V7ZA 4KYPA 1VNBA 5AQIA 3GL1A 2KBJA 1SNBA 2KBKA 1UGLA 4H5TA 2YIPA 5EXWA 2QWLA 3IUCA 5BN8A 2VY6A 2GL1A 2K35A 4FSVA 1I2UA 1NGHA 3FZHA 1K8BA 1BCGA 5EX5A 1HJOA 2N2RA 1BK8A 2KGQA 2YC1C 2QWPA 1C55A 1GPTA 2YBRC 1T7BA 5AQSA 2YEOA 2GMOA 3GDQA 5AQNA 1HX1A 1PTXA 2A7TA 4UAEF 1NGJA 5CY0A 1NRAA 2B68A 3LDPA 1ZFUA 1JKZA 3LDOA 1B7DA 5AQZA 1AHOA 1KV0A 3KOZA 1T7EA 5AQRA 2LY6A 1ZVGA 3QI7A 1VNAA 1I6GA 1C56A 5AQQA 4GNIA 4V1DC 1AYJA 2LT8A 2KYQA 3E7RL 1OZZA 2QWQA 3GKUA 3LDNA 2QWMA 4HWIA 5AQYA 5BN9A 1FH3A 5AQFA 1BA1A 1ICAA 2KBHA 2E3GA 1BUPA 3L56A 1ATRA 4H5NA 5BPNA 2NY8X 5AR0A 5AQPA 1BA0A 3KVGA 4FL9A 4IO8A 3C7NB 3QFPA 1MR4A 3QMLA 2LJMA 3AY9A 1NGDA 3KHWA 1NGAA 1P00A 4UAFE 5AQMA 1MYNA 5AQVA 2KSKA 1WT7A 1B3CA 3L6QA 3FZFA 1PE4A 2LN8A 5FPEA 2JDQD 5FPNA 1NGGA 2G2KA 1DJTA 1JXCA 5BPLA 1LQQA 1GPSA 4AEIA 3CW4A 5AQTA 1QQOA 1SEGA 2BRZA 3KOYA 4H5RA 4UJ0A 2MZ0A 1JZBA 1NGFA 3D2EB 3ATUA 1SN4A 1NPIA 2MN5A 3C7NA 2KJAA 1KAXA 1I6FA 1T1TA
chains in the Genus database with same CATH topology
2N69A 5KK4A 1DQ7A 4AB0A 1T7AA 1CN2A 1T0ZA 2LKBA 2NY9X 4HE7A 2M8BB 3PSMA 2LY5A 1OMYA 2N2QA 2E3FA 2E0HA 2ASCA 1NH5A 1BRZA 1LQIA 3E7UX 1ZYVA 2I61A 2KPYA 2LJ7A 4CQKA 1I2VA 1ZUTA 1ZU3A 1BMRA 2N66A 1P0AA 4HHFA 1CHZA 1SN1A 4AAZA 1PX9A 1ZYWA 1NE5A 1LQHA 2B3CA 1L4VA 1WMTA 1WWNA 2LR3A 2SN3A 2ATBA 1JZAA 1TI5A 1N4NA 1NRBA 1ZVEA 2LI7A 4KYPA 1VNBA 2KBJA 1SNBA 2KBKA 2GL1A 1I2UA 1BCGA 2N2RA 1BK8A 2KGQA 2YC1C 1C55A 1GPTA 2YBRC 1T7BA 2YEOA 1PTXA 2A7TA 5CY0A 1NRAA 2B68A 1ZFUA 1JKZA 1B7DA 1AHOA 1KV0A 1T7EA 2LY6A 1ZVGA 1VNAA 1I6GA 1C56A 4V1DC 1AYJA 2LT8A 2KYQA 3E7RL 1OZZA 1FH3A 1ICAA 2KBHA 2E3GA 2NY8X 1MR4A 2LJMA 1P00A 1MYNA 2KSKA 1WT7A 1B3CA 1PE4A 1DJTA 1JXCA 1GPSA 1LQQA 4AEIA 1SEGA 2BRZA 4UJ0A 2MZ0A 1JZBA 1SN4A 1NPIA 2KJAA 1I6FA 1T1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N69 A;  5KK4 A;  1DQ7 A;  4AB0 A;  1T7A A;  1CN2 A;  1T0Z A;  2LKB A;  2NY9 X;  4HE7 A;  2M8B B;  3PSM A;  2LY5 A;  1OMY A;  2N2Q A;  2E3F A;  2E0H A;  2ASC A;  1NH5 A;  1BRZ A;  1LQI A;  3E7U X;  1ZYV A;  2I61 A;  2KPY A;  2LJ7 A;  4CQK A;  1I2V A;  1ZUT A;  1ZU3 A;  1BMR A;  2N66 A;  1P0A A;  4HHF A;  1CHZ A;  1SN1 A;  4AAZ A;  1PX9 A;  1ZYW A;  1NE5 A;  1LQH A;  2B3C A;  1L4V A;  1WMT A;  1WWN A;  2LR3 A;  2SN3 A;  2ATB A;  1JZA A;  1TI5 A;  1N4N A;  1NRB A;  1ZVE A;  2LI7 A;  4KYP A;  1VNB A;  2KBJ A;  1SNB A;  2KBK A;  2GL1 A;  1I2U A;  1BCG A;  2N2R A;  1BK8 A;  2KGQ A;  2YC1 C;  1C55 A;  1GPT A;  2YBR C;  1T7B A;  2YEO A;  1PTX A;  2A7T A;  5CY0 A;  1NRA A;  2B68 A;  1ZFU A;  1JKZ A;  1B7D A;  1AHO A;  1KV0 A;  1T7E A;  2LY6 A;  1ZVG A;  1VNA A;  1I6G A;  1C56 A;  4V1D C;  1AYJ A;  2LT8 A;  2KYQ A;  3E7R L;  1OZZ A;  1FH3 A;  1ICA A;  2KBH A;  2E3G A;  2NY8 X;  1MR4 A;  2LJM A;  1P00 A;  1MYN A;  2KSK A;  1WT7 A;  1B3C A;  1PE4 A;  1DJT A;  1JXC A;  1GPS A;  1LQQ A;  4AEI A;  1SEG A;  2BRZ A;  4UJ0 A;  2MZ0 A;  1JZB A;  1SN4 A;  1NPI A;  2KJA A;  1I6F A;  1T1T A; 
#chains in the Genus database with same CATH topology
 1NGI A;  1YUW A;  2N69 A;  5AQG A;  5KK4 A;  2E2F A;  1POI A;  5EY4 A;  1DQ7 A;  4AB0 A;  1T7A A;  2E88 A;  3R2V A;  2QWN A;  3ATV A;  1DKG D;  1T0Z A;  2LKB A;  1CN2 A;  3CQX A;  2NY9 X;  4HE7 A;  1ATS A;  2M8B B;  2QXL A;  3FZL A;  3JXU A;  2LY5 A;  3PSM A;  1OMY A;  5AQU A;  2N2Q A;  3SF4 D;  3FE1 A;  2E3F A;  1S3X A;  3I33 A;  2YIO A;  2E0H A;  3LDQ A;  5EVZ A;  2ASC A;  3HSC A;  3D2E A;  2QWR A;  1HPM A;  1NH5 A;  5AQL A;  1BRZ A;  2KHO A;  1KAY A;  5F0X A;  5AQH A;  3A8Y A;  1LQI A;  3FZK A;  3D2F B;  3E7U X;  5AQW A;  4KBO A;  5BPM A;  1NGC A;  1ZYV A;  2I61 A;  2KPY A;  4H5W A;  4H5V A;  2LJ7 A;  2D56 A;  1NGE A;  3KP0 A;  5FPD A;  4CQK A;  1XRS B;  1I2V A;  1NGB A;  1ZUT A;  1ZU3 A;  5FPM A;  1BMR A;  2N66 A;  5AQJ A;  1P0A A;  2QW9 A;  3QFU A;  4HHF A;  1CHZ A;  1SN1 A;  4AAZ A;  1PX9 A;  1QQN A;  3KOX A;  5AQX A;  1ZYW A;  1NE5 A;  2QWO A;  2YIL A;  3KP1 A;  3FZM A;  2E8A A;  1LQH A;  3L4I A;  2BUP A;  2B3C A;  1L4V A;  1WMT A;  1WWN A;  2LR3 A;  2SN3 A;  5AQK A;  3D2F A;  3KC6 A;  1KAZ A;  2ATB A;  1JZA A;  5AQO A;  1TI5 A;  3LDL A;  3M3Z A;  4UAD E;  5F1X A;  2MBK A;  3BK3 C;  3KOW A;  1N4N A;  1NRB A;  1ZVE A;  2LI7 A;  5F2R A;  1QQM A;  2V7Z A;  4KYP A;  1VNB A;  5AQI A;  3GL1 A;  2KBJ A;  1SNB A;  2KBK A;  1UGL A;  4H5T A;  2YIP A;  5EXW A;  2QWL A;  3IUC A;  5BN8 A;  2VY6 A;  2GL1 A;  2K35 A;  4FSV A;  1I2U A;  1NGH A;  3FZH A;  1K8B A;  1BCG A;  5EX5 A;  1HJO A;  2N2R A;  1BK8 A;  2KGQ A;  2YC1 C;  2QWP A;  1C55 A;  1GPT A;  2YBR C;  1T7B A;  5AQS A;  2YEO A;  2GMO A;  3GDQ A;  5AQN A;  1HX1 A;  1PTX A;  2A7T A;  4UAE F;  1NGJ A;  5CY0 A;  1NRA A;  2B68 A;  3LDP A;  1ZFU A;  1JKZ A;  3LDO A;  1B7D A;  5AQZ A;  1AHO A;  1KV0 A;  3KOZ A;  1T7E A;  5AQR A;  2LY6 A;  1ZVG A;  3QI7 A;  1VNA A;  1I6G A;  1C56 A;  5AQQ A;  4GNI A;  4V1D C;  1AYJ A;  2LT8 A;  2KYQ A;  3E7R L;  1OZZ A;  2QWQ A;  3GKU A;  3LDN A;  2QWM A;  4HWI A;  5AQY A;  5BN9 A;  1FH3 A;  5AQF A;  1BA1 A;  1ICA A;  2KBH A;  2E3G A;  1BUP A;  3L56 A;  1ATR A;  4H5N A;  5BPN A;  2NY8 X;  5AR0 A;  5AQP A;  1BA0 A;  3KVG A;  4FL9 A;  4IO8 A;  3C7N B;  3QFP A;  1MR4 A;  3QML A;  2LJM A;  3AY9 A;  1NGD A;  3KHW A;  1NGA A;  1P00 A;  4UAF E;  5AQM A;  1MYN A;  5AQV A;  2KSK A;  1WT7 A;  1B3C A;  3L6Q A;  3FZF A;  1PE4 A;  2LN8 A;  5FPE A;  2JDQ D;  5FPN A;  1NGG A;  2G2K A;  1DJT A;  1JXC A;  5BPL A;  1LQQ A;  1GPS A;  4AEI A;  3CW4 A;  5AQT A;  1QQO A;  1SEG A;  2BRZ A;  3KOY A;  4H5R A;  4UJ0 A;  2MZ0 A;  1JZB A;  1NGF A;  3D2E B;  3ATU A;  1SN4 A;  1NPI A;  2MN5 A;  3C7N A;  2KJA A;  1KAX A;  1I6F A;  1T1T A; 
#chains in the Genus database with same CATH homology
 2N69 A;  5KK4 A;  1DQ7 A;  4AB0 A;  1T7A A;  1CN2 A;  1T0Z A;  2LKB A;  2NY9 X;  4HE7 A;  2M8B B;  3PSM A;  2LY5 A;  1OMY A;  2N2Q A;  2E3F A;  2E0H A;  2ASC A;  1NH5 A;  1BRZ A;  1LQI A;  3E7U X;  1ZYV A;  2I61 A;  2KPY A;  2LJ7 A;  4CQK A;  1I2V A;  1ZUT A;  1ZU3 A;  1BMR A;  2N66 A;  1P0A A;  4HHF A;  1CHZ A;  1SN1 A;  4AAZ A;  1PX9 A;  1ZYW A;  1NE5 A;  1LQH A;  2B3C A;  1L4V A;  1WMT A;  1WWN A;  2LR3 A;  2SN3 A;  2ATB A;  1JZA A;  1TI5 A;  1N4N A;  1NRB A;  1ZVE A;  2LI7 A;  4KYP A;  1VNB A;  2KBJ A;  1SNB A;  2KBK A;  2GL1 A;  1I2U A;  1BCG A;  2N2R A;  1BK8 A;  2KGQ A;  2YC1 C;  1C55 A;  1GPT A;  2YBR C;  1T7B A;  2YEO A;  1PTX A;  2A7T A;  5CY0 A;  1NRA A;  2B68 A;  1ZFU A;  1JKZ A;  1B7D A;  1AHO A;  1KV0 A;  1T7E A;  2LY6 A;  1ZVG A;  1VNA A;  1I6G A;  1C56 A;  4V1D C;  1AYJ A;  2LT8 A;  2KYQ A;  3E7R L;  1OZZ A;  1FH3 A;  1ICA A;  2KBH A;  2E3G A;  2NY8 X;  1MR4 A;  2LJM A;  1P00 A;  1MYN A;  2KSK A;  1WT7 A;  1B3C A;  1PE4 A;  1DJT A;  1JXC A;  1GPS A;  1LQQ A;  4AEI A;  1SEG A;  2BRZ A;  4UJ0 A;  2MZ0 A;  1JZB A;  1SN4 A;  1NPI A;  2KJA A;  1I6F A;  1T1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...