2LJMA

Solution structure of cssii
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
82
structure length
82
Chain Sequence
b'MRGSHHHHHHGSIEGRKEGYLVSKSTGCKYECLKLGDNDYCLRECKQQYGKSSGGYCYAFACWCTHLYEQAVVWPLPNKTCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-mammal toxin Css2
publication title Solution structure of native and recombinant expressed toxin CssII from the venom of the scorpion Centruroides suffusus suffusus, and their effects on Nav1.5 Sodium channels.
pubmed doi rcsb
molecule tags Toxin
total genus 5
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2011-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2ljmA01
1LQHA 1N4NA 1ZUTA 1PX9A 2LJMA 1ZVEA 1I2VA 2YBRC 3E7UX 2N2RA 1PE4A 4KYPA 2A7TA 1GPTA 1OMYA 1JKZA 1BCGA 1T7AA 2YEOA 2YC1C 2E0HA 1I6GA 2LKBA 1CN2A 1NRBA 2M8BB 1I2UA 2KBKA 5KK4A 2BRZA 1ICAA 1FH3A 1NPIA 2KBJA 1SNBA 1L4VA 4CQKA 2N66A 2ASCA 2I61A 2ATBA 4AEIA 1VNBA 1SN4A 1C56A 2NY9X 1BK8A 1NE5A 1VNAA 2GL1A 1KV0A 1T1TA 2B3CA 2B68A 4HE7A 1P00A 2KPYA 1JZAA 1SEGA 1WT7A 1LQIA 1JZBA 2LY6A 2MZ0A 1WWNA 1ZFUA 2NY8X 4V1DC 1ZYVA 1GPSA 1OZZA 2LT8A 1PTXA 2N69A 3E7RL 5CY0A 1C55A 1TI5A 1DJTA 2LI7A 1JXCA 2KSKA 2KGQA 1I6FA 2LY5A 1T7BA 2LJ7A 1T7EA 2KBHA 1ZYWA 1BMRA 1MYNA 1ZVGA 1NH5A 1WMTA 1AHOA 1T0ZA 4AAZA 1AYJA 4UJ0A 4HHFA 2E3GA 1CHZA 1SN1A 2LR3A 1B7DA 1LQQA 1NRAA 1ZU3A 1MR4A 2SN3A 1B3CA 4AB0A 2KYQA 3PSMA 1DQ7A 1BRZA 1P0AA 2E3FA 2KJAA 2N2QA
chains in the Genus database with same CATH superfamily
1LQHA 2K35A 5AQZA 2E2FA 1N4NA 1ZUTA 1NGFA 3ATUA 3FZFA 3QFPA 4FL9A 1PX9A 2QXLA 1KAZA 2LJMA 4FSVA 1ZVEA 1I2VA 3FZHA 2YBRC 3E7UX 2N2RA 3D2EB 1PE4A 3IUCA 2A7TA 3KP0A 3CQXA 1OMYA 3L4IA 4KYPA 1DKGD 5AQGA 1JKZA 1GPTA 1BCGA 1T7AA 1ATRA 3D2FA 2YEOA 2V7ZA 1QQNA 2E0HA 2YC1C 1BA1A 1I6GA 2LKBA 3FE1A 2E8AA 3KP1A 2D56A 1NGDA 1CN2A 3I33A 1NRBA 2M8BB 1I2UA 2E88A 3CW4A 5AQHA 1KAXA 5F0XA 5AQIA 2KBKA 3A8YA 5KK4A 2BRZA 1NGJA 5AQRA 3D2FB 5AQUA 1ICAA 1XRSB 2QWOA 2QWQA 3LDNA 1FH3A 5EXWA 2KHOA 5AQMA 1NPIA 3ATVA 3L56A 2KBJA 1SNBA 2QW9A 1L4VA 4CQKA 1NGAA 1NGIA 2N66A 4HWIA 3KVGA 2ASCA 2I61A 5F2RA 2ATBA 3GKUA 3SF4D 1VNBA 4AEIA 2YIPA 1HPMA 1SN4A 1C56A 5AQFA 2NY9X 1BK8A 2LN8A 1NE5A 1VNAA 2YILA 3KHWA 5AQJA 2QWMA 3M3ZA 2GL1A 1S3XA 4H5TA 1KV0A 1POIA 3LDOA 1T1TA 2B3CA 2B68A 2QWLA 1NGHA 3R2VA 3LDPA 5F1XA 1QQMA 3KOYA 3BK3C 3LDLA 1YUWA 5BPLA 4HE7A 4IO8A 1P00A 2KPYA 5AQOA 5AQVA 1JZAA 1SEGA 3HSCA 1WT7A 1LQIA 1JZBA 1BUPA 2LY6A 1WWNA 1ZFUA 2MZ0A 2NY8X 1ZYVA 3QFUA 4V1DC 1GPSA 3AY9A 1OZZA 2BUPA 2LT8A 1PTXA 2N69A 3E7RL 5CY0A 3JXUA 2QWRA 3FZKA 1C55A 1TI5A 2QWPA 3QI7A 1ATSA 3C7NA 1DJTA 2LI7A 5AQYA 1JXCA 2KSKA 2KGQA 4H5WA 2QWNA 2G2KA 1I6FA 2LY5A 1QQOA 5FPNA 5AQNA 1T7BA 2LJ7A 1T7EA 2YIOA 2KBHA 1ZYWA 3GDQA 3L6QA 3FZLA 1BMRA 1MYNA 1ZVGA 2MN5A 1HJOA 1NH5A 1NGEA 3C7NB 4UADE 1WMTA 5AQPA 5AR0A 5BN9A 1AHOA 5BN8A 1KAYA 4GNIA 5BPNA 4H5RA 4H5NA 3KOWA 5BPMA 1NGCA 1T0ZA 4UAEF 5FPMA 3QMLA 3GL1A 1NGBA 5AQKA 4AAZA 3KOZA 1AYJA 2GMOA 1UGLA 5EVZA 5AQWA 4UJ0A 4HHFA 4H5VA 2E3GA 1CHZA 1SN1A 5FPDA 2LR3A 1B7DA 1LQQA 1NRAA 1ZU3A 3KC6A 1MR4A 2SN3A 5AQLA 5AQXA 5EX5A 5AQQA 4AB0A 3LDQA 4UAFE 2JDQD 2KYQA 5EY4A 4KBOA 1NGGA 1B3CA 3PSMA 5AQTA 1DQ7A 3KOXA 1BRZA 2MBKA 5AQSA 1P0AA 2E3FA 2KJAA 3D2EA 5FPEA 1BA0A 1K8BA 2N2QA 1HX1A 3FZMA 2VY6A
chains in the Genus database with same CATH topology
1LQHA 1N4NA 1ZUTA 1PX9A 2LJMA 1ZVEA 1I2VA 2YBRC 3E7UX 2N2RA 1PE4A 4KYPA 2A7TA 1GPTA 1OMYA 1JKZA 1BCGA 1T7AA 2YEOA 2YC1C 2E0HA 1I6GA 2LKBA 1CN2A 1NRBA 2M8BB 1I2UA 2KBKA 5KK4A 2BRZA 1ICAA 1FH3A 1NPIA 2KBJA 1SNBA 1L4VA 4CQKA 2N66A 2ASCA 2I61A 2ATBA 4AEIA 1VNBA 1SN4A 1C56A 2NY9X 1BK8A 1NE5A 1VNAA 2GL1A 1KV0A 1T1TA 2B3CA 2B68A 4HE7A 1P00A 2KPYA 1JZAA 1SEGA 1WT7A 1LQIA 1JZBA 2LY6A 2MZ0A 1WWNA 1ZFUA 2NY8X 4V1DC 1ZYVA 1GPSA 1OZZA 2LT8A 1PTXA 2N69A 3E7RL 5CY0A 1C55A 1TI5A 1DJTA 2LI7A 1JXCA 2KSKA 2KGQA 1I6FA 2LY5A 1T7BA 2LJ7A 1T7EA 2KBHA 1ZYWA 1BMRA 1MYNA 1ZVGA 1NH5A 1WMTA 1AHOA 1T0ZA 4AAZA 1AYJA 4UJ0A 4HHFA 2E3GA 1CHZA 1SN1A 2LR3A 1B7DA 1LQQA 1NRAA 1ZU3A 1MR4A 2SN3A 1B3CA 4AB0A 2KYQA 3PSMA 1DQ7A 1BRZA 1P0AA 2E3FA 2KJAA 2N2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQH A;  1N4N A;  1ZUT A;  1PX9 A;  2LJM A;  1ZVE A;  1I2V A;  2YBR C;  3E7U X;  2N2R A;  1PE4 A;  4KYP A;  2A7T A;  1GPT A;  1OMY A;  1JKZ A;  1BCG A;  1T7A A;  2YEO A;  2YC1 C;  2E0H A;  1I6G A;  2LKB A;  1CN2 A;  1NRB A;  2M8B B;  1I2U A;  2KBK A;  5KK4 A;  2BRZ A;  1ICA A;  1FH3 A;  1NPI A;  2KBJ A;  1SNB A;  1L4V A;  4CQK A;  2N66 A;  2ASC A;  2I61 A;  2ATB A;  4AEI A;  1VNB A;  1SN4 A;  1C56 A;  2NY9 X;  1BK8 A;  1NE5 A;  1VNA A;  2GL1 A;  1KV0 A;  1T1T A;  2B3C A;  2B68 A;  4HE7 A;  1P00 A;  2KPY A;  1JZA A;  1SEG A;  1WT7 A;  1LQI A;  1JZB A;  2LY6 A;  2MZ0 A;  1WWN A;  1ZFU A;  2NY8 X;  4V1D C;  1ZYV A;  1GPS A;  1OZZ A;  2LT8 A;  1PTX A;  2N69 A;  3E7R L;  5CY0 A;  1C55 A;  1TI5 A;  1DJT A;  2LI7 A;  1JXC A;  2KSK A;  2KGQ A;  1I6F A;  2LY5 A;  1T7B A;  2LJ7 A;  1T7E A;  2KBH A;  1ZYW A;  1BMR A;  1MYN A;  1ZVG A;  1NH5 A;  1WMT A;  1AHO A;  1T0Z A;  4AAZ A;  1AYJ A;  4UJ0 A;  4HHF A;  2E3G A;  1CHZ A;  1SN1 A;  2LR3 A;  1B7D A;  1LQQ A;  1NRA A;  1ZU3 A;  1MR4 A;  2SN3 A;  1B3C A;  4AB0 A;  2KYQ A;  3PSM A;  1DQ7 A;  1BRZ A;  1P0A A;  2E3F A;  2KJA A;  2N2Q A; 
#chains in the Genus database with same CATH topology
 1LQH A;  2K35 A;  5AQZ A;  2E2F A;  1N4N A;  1ZUT A;  1NGF A;  3ATU A;  3FZF A;  3QFP A;  4FL9 A;  1PX9 A;  2QXL A;  1KAZ A;  2LJM A;  4FSV A;  1ZVE A;  1I2V A;  3FZH A;  2YBR C;  3E7U X;  2N2R A;  3D2E B;  1PE4 A;  3IUC A;  2A7T A;  3KP0 A;  3CQX A;  1OMY A;  3L4I A;  4KYP A;  1DKG D;  5AQG A;  1JKZ A;  1GPT A;  1BCG A;  1T7A A;  1ATR A;  3D2F A;  2YEO A;  2V7Z A;  1QQN A;  2E0H A;  2YC1 C;  1BA1 A;  1I6G A;  2LKB A;  3FE1 A;  2E8A A;  3KP1 A;  2D56 A;  1NGD A;  1CN2 A;  3I33 A;  1NRB A;  2M8B B;  1I2U A;  2E88 A;  3CW4 A;  5AQH A;  1KAX A;  5F0X A;  5AQI A;  2KBK A;  3A8Y A;  5KK4 A;  2BRZ A;  1NGJ A;  5AQR A;  3D2F B;  5AQU A;  1ICA A;  1XRS B;  2QWO A;  2QWQ A;  3LDN A;  1FH3 A;  5EXW A;  2KHO A;  5AQM A;  1NPI A;  3ATV A;  3L56 A;  2KBJ A;  1SNB A;  2QW9 A;  1L4V A;  4CQK A;  1NGA A;  1NGI A;  2N66 A;  4HWI A;  3KVG A;  2ASC A;  2I61 A;  5F2R A;  2ATB A;  3GKU A;  3SF4 D;  1VNB A;  4AEI A;  2YIP A;  1HPM A;  1SN4 A;  1C56 A;  5AQF A;  2NY9 X;  1BK8 A;  2LN8 A;  1NE5 A;  1VNA A;  2YIL A;  3KHW A;  5AQJ A;  2QWM A;  3M3Z A;  2GL1 A;  1S3X A;  4H5T A;  1KV0 A;  1POI A;  3LDO A;  1T1T A;  2B3C A;  2B68 A;  2QWL A;  1NGH A;  3R2V A;  3LDP A;  5F1X A;  1QQM A;  3KOY A;  3BK3 C;  3LDL A;  1YUW A;  5BPL A;  4HE7 A;  4IO8 A;  1P00 A;  2KPY A;  5AQO A;  5AQV A;  1JZA A;  1SEG A;  3HSC A;  1WT7 A;  1LQI A;  1JZB A;  1BUP A;  2LY6 A;  1WWN A;  1ZFU A;  2MZ0 A;  2NY8 X;  1ZYV A;  3QFU A;  4V1D C;  1GPS A;  3AY9 A;  1OZZ A;  2BUP A;  2LT8 A;  1PTX A;  2N69 A;  3E7R L;  5CY0 A;  3JXU A;  2QWR A;  3FZK A;  1C55 A;  1TI5 A;  2QWP A;  3QI7 A;  1ATS A;  3C7N A;  1DJT A;  2LI7 A;  5AQY A;  1JXC A;  2KSK A;  2KGQ A;  4H5W A;  2QWN A;  2G2K A;  1I6F A;  2LY5 A;  1QQO A;  5FPN A;  5AQN A;  1T7B A;  2LJ7 A;  1T7E A;  2YIO A;  2KBH A;  1ZYW A;  3GDQ A;  3L6Q A;  3FZL A;  1BMR A;  1MYN A;  1ZVG A;  2MN5 A;  1HJO A;  1NH5 A;  1NGE A;  3C7N B;  4UAD E;  1WMT A;  5AQP A;  5AR0 A;  5BN9 A;  1AHO A;  5BN8 A;  1KAY A;  4GNI A;  5BPN A;  4H5R A;  4H5N A;  3KOW A;  5BPM A;  1NGC A;  1T0Z A;  4UAE F;  5FPM A;  3QML A;  3GL1 A;  1NGB A;  5AQK A;  4AAZ A;  3KOZ A;  1AYJ A;  2GMO A;  1UGL A;  5EVZ A;  5AQW A;  4UJ0 A;  4HHF A;  4H5V A;  2E3G A;  1CHZ A;  1SN1 A;  5FPD A;  2LR3 A;  1B7D A;  1LQQ A;  1NRA A;  1ZU3 A;  3KC6 A;  1MR4 A;  2SN3 A;  5AQL A;  5AQX A;  5EX5 A;  5AQQ A;  4AB0 A;  3LDQ A;  4UAF E;  2JDQ D;  2KYQ A;  5EY4 A;  4KBO A;  1NGG A;  1B3C A;  3PSM A;  5AQT A;  1DQ7 A;  3KOX A;  1BRZ A;  2MBK A;  5AQS A;  1P0A A;  2E3F A;  2KJA A;  3D2E A;  5FPE A;  1BA0 A;  1K8B A;  2N2Q A;  1HX1 A;  3FZM A;  2VY6 A; 
#chains in the Genus database with same CATH homology
 1LQH A;  1N4N A;  1ZUT A;  1PX9 A;  2LJM A;  1ZVE A;  1I2V A;  2YBR C;  3E7U X;  2N2R A;  1PE4 A;  4KYP A;  2A7T A;  1GPT A;  1OMY A;  1JKZ A;  1BCG A;  1T7A A;  2YEO A;  2YC1 C;  2E0H A;  1I6G A;  2LKB A;  1CN2 A;  1NRB A;  2M8B B;  1I2U A;  2KBK A;  5KK4 A;  2BRZ A;  1ICA A;  1FH3 A;  1NPI A;  2KBJ A;  1SNB A;  1L4V A;  4CQK A;  2N66 A;  2ASC A;  2I61 A;  2ATB A;  4AEI A;  1VNB A;  1SN4 A;  1C56 A;  2NY9 X;  1BK8 A;  1NE5 A;  1VNA A;  2GL1 A;  1KV0 A;  1T1T A;  2B3C A;  2B68 A;  4HE7 A;  1P00 A;  2KPY A;  1JZA A;  1SEG A;  1WT7 A;  1LQI A;  1JZB A;  2LY6 A;  2MZ0 A;  1WWN A;  1ZFU A;  2NY8 X;  4V1D C;  1ZYV A;  1GPS A;  1OZZ A;  2LT8 A;  1PTX A;  2N69 A;  3E7R L;  5CY0 A;  1C55 A;  1TI5 A;  1DJT A;  2LI7 A;  1JXC A;  2KSK A;  2KGQ A;  1I6F A;  2LY5 A;  1T7B A;  2LJ7 A;  1T7E A;  2KBH A;  1ZYW A;  1BMR A;  1MYN A;  1ZVG A;  1NH5 A;  1WMT A;  1AHO A;  1T0Z A;  4AAZ A;  1AYJ A;  4UJ0 A;  4HHF A;  2E3G A;  1CHZ A;  1SN1 A;  2LR3 A;  1B7D A;  1LQQ A;  1NRA A;  1ZU3 A;  1MR4 A;  2SN3 A;  1B3C A;  4AB0 A;  2KYQ A;  3PSM A;  1DQ7 A;  1BRZ A;  1P0A A;  2E3F A;  2KJA A;  2N2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...