1ZVGA

Crystal structure of mutant k8dp9s of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
NSVRDAYIADSHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Alpha-like neurotoxin BmK-I
publication title Structural basis for the voltage-gated Na+ channel selectivity of the scorpion alpha-like toxin BmK M1
pubmed doi rcsb
source organism Mesobuthus martensii
total genus 17
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1zvgA00
1MYNA 1JXCA 1JKZA 1OMYA 2LY6A 1SN1A 1NPIA 4CQKA 2KYQA 1VNAA 1PE4A 2MZ0A 1WWNA 1VNBA 1PX9A 1I2UA 1T0ZA 1B7DA 2SN3A 2B68A 3PSMA 2N69A 1P0AA 1ZVGA 2YBRC 2ASCA 1T7EA 5KK4A 2NY9X 2LT8A 2N2QA 2LR3A 1L4VA 2A7TA 1ZUTA 2N2RA 1ZVEA 1AHOA 1N4NA 1ZYVA 2I61A 1KV0A 2KJAA 1SEGA 2M8BB 2E0HA 1P00A 1T7AA 1LQHA 1MR4A 2ATBA 2KPYA 1BCGA 1JZBA 1WT7A 4KYPA 1GPSA 4AEIA 4AB0A 2LJ7A 1ZU3A 1GPTA 2KBKA 1C55A 1LQQA 2LI7A 2E3FA 1ZFUA 1C56A 1NH5A 1NRBA 1I6FA 2LKBA 3E7UX 2BRZA 1DQ7A 1NE5A 2B3CA 1SNBA 1ZYWA 1TI5A 1I6GA 1WMTA 2NY8X 5CY0A 2KGQA 1BRZA 4AAZA 1I2VA 1LQIA 1B3CA 1JZAA 1BK8A 1OZZA 1FH3A 1ICAA 1BMRA 1SN4A 2LJMA 1T7BA 2N66A 3E7RL 2KSKA 2E3GA 2YEOA 1NRAA 1T1TA 2LY5A 1CN2A 1DJTA 2KBHA 1CHZA 2GL1A 4UJ0A 4HE7A 2YC1C 4V1DC 1AYJA 2KBJA 4HHFA 1PTXA
chains in the Genus database with same CATH superfamily
1MYNA 1JXCA 1POIA 3KOZA 1JKZA 3LDPA 1OMYA 3FZLA 2LY6A 3FZMA 1SN1A 5AQHA 1NPIA 4UAEF 1YUWA 4CQKA 5FPEA 1DKGD 2KYQA 5EY4A 1VNAA 4H5WA 1PE4A 2E2FA 3KP1A 2MBKA 2MZ0A 3BK3C 3FE1A 3KOWA 3QMLA 2KHOA 4H5TA 5F2RA 1WWNA 3CW4A 1VNBA 3D2FA 1PX9A 3KP0A 5EX5A 1I2UA 1T0ZA 1B7DA 2SN3A 3FZHA 2B68A 4UAFE 2V7ZA 3PSMA 2N69A 3AY9A 2YIOA 1NGCA 2QWPA 1P0AA 1ZVGA 3C7NA 2YBRC 1ATSA 2ASCA 5EXWA 5BN8A 5AQVA 3L6QA 3R2VA 4FL9A 1T7EA 5KK4A 2NY9X 2LT8A 1K8BA 2N2QA 2LR3A 1L4VA 5AQRA 2A7TA 2QWNA 2MN5A 1HJOA 4IO8A 4UADE 1ZUTA 2N2RA 5AQSA 5BPMA 5AQIA 2D56A 1ZVEA 1AHOA 3I33A 3QFUA 5AQJA 1N4NA 1HX1A 1ZYVA 2QWMA 5AQQA 3QFPA 1NGGA 2I61A 1KV0A 2KJAA 1SEGA 2M8BB 2E0HA 5EVZA 3L56A 1P00A 1T7AA 1LQHA 1MR4A 2ATBA 3A8YA 2KPYA 4H5NA 1BCGA 1JZBA 1WT7A 1S3XA 2QW9A 4KYPA 1QQOA 3D2EB 4AEIA 1NGAA 3ATUA 1GPSA 4AB0A 3JXUA 2LJ7A 1ZU3A 1NGHA 1GPTA 2GMOA 3FZFA 2KBKA 3ATVA 1C55A 1LQQA 2LI7A 2E3FA 2LN8A 2G2KA 1KAZA 1QQMA 1ZFUA 3LDNA 5F1XA 1C56A 1UGLA 3SF4D 3KVGA 1NH5A 3HSCA 1NRBA 1I6FA 2JDQD 5AQWA 5AQKA 1NGJA 2LKBA 2YILA 3E7UX 2BRZA 1NGBA 1DQ7A 1NE5A 4FSVA 2QXLA 5F0XA 3LDQA 5BN9A 2B3CA 5AQOA 1SNBA 1ZYWA 4HWIA 2YIPA 3D2FB 1NGIA 1TI5A 1I6GA 5AQLA 1NGEA 1WMTA 3GL1A 2NY8X 3LDLA 4GNIA 1KAXA 2QWOA 5CY0A 2KGQA 3L4IA 4AAZA 1BRZA 5AQGA 3KC6A 3QI7A 2E88A 1I2VA 2VY6A 3KOYA 5AQPA 2QWLA 3C7NB 1LQIA 5AQZA 1B3CA 1JZAA 1BK8A 1OZZA 4H5VA 2E8AA 1FH3A 1ATRA 1HPMA 1ICAA 1BMRA 1SN4A 5AQYA 3LDOA 2QWQA 2LJMA 5AQNA 1T7BA 3KHWA 3FZKA 2N66A 3CQXA 3E7RL 2KSKA 5AR0A 1NGFA 2E3GA 2YEOA 3D2EA 5FPMA 1NRAA 1XRSB 1BUPA 1T1TA 2LY5A 1KAYA 1NGDA 3IUCA 1CN2A 5AQTA 5BPLA 1DJTA 3GKUA 5FPDA 2QWRA 2BUPA 5AQMA 2KBHA 2K35A 4KBOA 5AQFA 5AQUA 1CHZA 4H5RA 2GL1A 5AQXA 4HE7A 2YC1C 1BA1A 4V1DC 5FPNA 4UJ0A 3GDQA 5BPNA 1AYJA 2KBJA 3KOXA 3M3ZA 4HHFA 1QQNA 1PTXA 1BA0A
chains in the Genus database with same CATH topology
1MYNA 1JXCA 1JKZA 1OMYA 2LY6A 1SN1A 1NPIA 4CQKA 2KYQA 1VNAA 1PE4A 2MZ0A 1WWNA 1VNBA 1PX9A 1I2UA 1T0ZA 1B7DA 2SN3A 2B68A 3PSMA 2N69A 1P0AA 1ZVGA 2YBRC 2ASCA 1T7EA 5KK4A 2NY9X 2LT8A 2N2QA 2LR3A 1L4VA 2A7TA 1ZUTA 2N2RA 1ZVEA 1AHOA 1N4NA 1ZYVA 2I61A 1KV0A 2KJAA 1SEGA 2M8BB 2E0HA 1P00A 1T7AA 1LQHA 1MR4A 2ATBA 2KPYA 1BCGA 1JZBA 1WT7A 4KYPA 1GPSA 4AEIA 4AB0A 2LJ7A 1ZU3A 1GPTA 2KBKA 1C55A 1LQQA 2LI7A 2E3FA 1ZFUA 1C56A 1NH5A 1NRBA 1I6FA 2LKBA 3E7UX 2BRZA 1DQ7A 1NE5A 2B3CA 1SNBA 1ZYWA 1TI5A 1I6GA 1WMTA 2NY8X 5CY0A 2KGQA 1BRZA 4AAZA 1I2VA 1LQIA 1B3CA 1JZAA 1BK8A 1OZZA 1FH3A 1ICAA 1BMRA 1SN4A 2LJMA 1T7BA 2N66A 3E7RL 2KSKA 2E3GA 2YEOA 1NRAA 1T1TA 2LY5A 1CN2A 1DJTA 2KBHA 1CHZA 2GL1A 4UJ0A 4HE7A 2YC1C 4V1DC 1AYJA 2KBJA 4HHFA 1PTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MYN A;  1JXC A;  1JKZ A;  1OMY A;  2LY6 A;  1SN1 A;  1NPI A;  4CQK A;  2KYQ A;  1VNA A;  1PE4 A;  2MZ0 A;  1WWN A;  1VNB A;  1PX9 A;  1I2U A;  1T0Z A;  1B7D A;  2SN3 A;  2B68 A;  3PSM A;  2N69 A;  1P0A A;  1ZVG A;  2YBR C;  2ASC A;  1T7E A;  5KK4 A;  2NY9 X;  2LT8 A;  2N2Q A;  2LR3 A;  1L4V A;  2A7T A;  1ZUT A;  2N2R A;  1ZVE A;  1AHO A;  1N4N A;  1ZYV A;  2I61 A;  1KV0 A;  2KJA A;  1SEG A;  2M8B B;  2E0H A;  1P00 A;  1T7A A;  1LQH A;  1MR4 A;  2ATB A;  2KPY A;  1BCG A;  1JZB A;  1WT7 A;  4KYP A;  1GPS A;  4AEI A;  4AB0 A;  2LJ7 A;  1ZU3 A;  1GPT A;  2KBK A;  1C55 A;  1LQQ A;  2LI7 A;  2E3F A;  1ZFU A;  1C56 A;  1NH5 A;  1NRB A;  1I6F A;  2LKB A;  3E7U X;  2BRZ A;  1DQ7 A;  1NE5 A;  2B3C A;  1SNB A;  1ZYW A;  1TI5 A;  1I6G A;  1WMT A;  2NY8 X;  5CY0 A;  2KGQ A;  1BRZ A;  4AAZ A;  1I2V A;  1LQI A;  1B3C A;  1JZA A;  1BK8 A;  1OZZ A;  1FH3 A;  1ICA A;  1BMR A;  1SN4 A;  2LJM A;  1T7B A;  2N66 A;  3E7R L;  2KSK A;  2E3G A;  2YEO A;  1NRA A;  1T1T A;  2LY5 A;  1CN2 A;  1DJT A;  2KBH A;  1CHZ A;  2GL1 A;  4UJ0 A;  4HE7 A;  2YC1 C;  4V1D C;  1AYJ A;  2KBJ A;  4HHF A;  1PTX A; 
#chains in the Genus database with same CATH topology
 1MYN A;  1JXC A;  1POI A;  3KOZ A;  1JKZ A;  3LDP A;  1OMY A;  3FZL A;  2LY6 A;  3FZM A;  1SN1 A;  5AQH A;  1NPI A;  4UAE F;  1YUW A;  4CQK A;  5FPE A;  1DKG D;  2KYQ A;  5EY4 A;  1VNA A;  4H5W A;  1PE4 A;  2E2F A;  3KP1 A;  2MBK A;  2MZ0 A;  3BK3 C;  3FE1 A;  3KOW A;  3QML A;  2KHO A;  4H5T A;  5F2R A;  1WWN A;  3CW4 A;  1VNB A;  3D2F A;  1PX9 A;  3KP0 A;  5EX5 A;  1I2U A;  1T0Z A;  1B7D A;  2SN3 A;  3FZH A;  2B68 A;  4UAF E;  2V7Z A;  3PSM A;  2N69 A;  3AY9 A;  2YIO A;  1NGC A;  2QWP A;  1P0A A;  1ZVG A;  3C7N A;  2YBR C;  1ATS A;  2ASC A;  5EXW A;  5BN8 A;  5AQV A;  3L6Q A;  3R2V A;  4FL9 A;  1T7E A;  5KK4 A;  2NY9 X;  2LT8 A;  1K8B A;  2N2Q A;  2LR3 A;  1L4V A;  5AQR A;  2A7T A;  2QWN A;  2MN5 A;  1HJO A;  4IO8 A;  4UAD E;  1ZUT A;  2N2R A;  5AQS A;  5BPM A;  5AQI A;  2D56 A;  1ZVE A;  1AHO A;  3I33 A;  3QFU A;  5AQJ A;  1N4N A;  1HX1 A;  1ZYV A;  2QWM A;  5AQQ A;  3QFP A;  1NGG A;  2I61 A;  1KV0 A;  2KJA A;  1SEG A;  2M8B B;  2E0H A;  5EVZ A;  3L56 A;  1P00 A;  1T7A A;  1LQH A;  1MR4 A;  2ATB A;  3A8Y A;  2KPY A;  4H5N A;  1BCG A;  1JZB A;  1WT7 A;  1S3X A;  2QW9 A;  4KYP A;  1QQO A;  3D2E B;  4AEI A;  1NGA A;  3ATU A;  1GPS A;  4AB0 A;  3JXU A;  2LJ7 A;  1ZU3 A;  1NGH A;  1GPT A;  2GMO A;  3FZF A;  2KBK A;  3ATV A;  1C55 A;  1LQQ A;  2LI7 A;  2E3F A;  2LN8 A;  2G2K A;  1KAZ A;  1QQM A;  1ZFU A;  3LDN A;  5F1X A;  1C56 A;  1UGL A;  3SF4 D;  3KVG A;  1NH5 A;  3HSC A;  1NRB A;  1I6F A;  2JDQ D;  5AQW A;  5AQK A;  1NGJ A;  2LKB A;  2YIL A;  3E7U X;  2BRZ A;  1NGB A;  1DQ7 A;  1NE5 A;  4FSV A;  2QXL A;  5F0X A;  3LDQ A;  5BN9 A;  2B3C A;  5AQO A;  1SNB A;  1ZYW A;  4HWI A;  2YIP A;  3D2F B;  1NGI A;  1TI5 A;  1I6G A;  5AQL A;  1NGE A;  1WMT A;  3GL1 A;  2NY8 X;  3LDL A;  4GNI A;  1KAX A;  2QWO A;  5CY0 A;  2KGQ A;  3L4I A;  4AAZ A;  1BRZ A;  5AQG A;  3KC6 A;  3QI7 A;  2E88 A;  1I2V A;  2VY6 A;  3KOY A;  5AQP A;  2QWL A;  3C7N B;  1LQI A;  5AQZ A;  1B3C A;  1JZA A;  1BK8 A;  1OZZ A;  4H5V A;  2E8A A;  1FH3 A;  1ATR A;  1HPM A;  1ICA A;  1BMR A;  1SN4 A;  5AQY A;  3LDO A;  2QWQ A;  2LJM A;  5AQN A;  1T7B A;  3KHW A;  3FZK A;  2N66 A;  3CQX A;  3E7R L;  2KSK A;  5AR0 A;  1NGF A;  2E3G A;  2YEO A;  3D2E A;  5FPM A;  1NRA A;  1XRS B;  1BUP A;  1T1T A;  2LY5 A;  1KAY A;  1NGD A;  3IUC A;  1CN2 A;  5AQT A;  5BPL A;  1DJT A;  3GKU A;  5FPD A;  2QWR A;  2BUP A;  5AQM A;  2KBH A;  2K35 A;  4KBO A;  5AQF A;  5AQU A;  1CHZ A;  4H5R A;  2GL1 A;  5AQX A;  4HE7 A;  2YC1 C;  1BA1 A;  4V1D C;  5FPN A;  4UJ0 A;  3GDQ A;  5BPN A;  1AYJ A;  2KBJ A;  3KOX A;  3M3Z A;  4HHF A;  1QQN A;  1PTX A;  1BA0 A; 
#chains in the Genus database with same CATH homology
 1MYN A;  1JXC A;  1JKZ A;  1OMY A;  2LY6 A;  1SN1 A;  1NPI A;  4CQK A;  2KYQ A;  1VNA A;  1PE4 A;  2MZ0 A;  1WWN A;  1VNB A;  1PX9 A;  1I2U A;  1T0Z A;  1B7D A;  2SN3 A;  2B68 A;  3PSM A;  2N69 A;  1P0A A;  1ZVG A;  2YBR C;  2ASC A;  1T7E A;  5KK4 A;  2NY9 X;  2LT8 A;  2N2Q A;  2LR3 A;  1L4V A;  2A7T A;  1ZUT A;  2N2R A;  1ZVE A;  1AHO A;  1N4N A;  1ZYV A;  2I61 A;  1KV0 A;  2KJA A;  1SEG A;  2M8B B;  2E0H A;  1P00 A;  1T7A A;  1LQH A;  1MR4 A;  2ATB A;  2KPY A;  1BCG A;  1JZB A;  1WT7 A;  4KYP A;  1GPS A;  4AEI A;  4AB0 A;  2LJ7 A;  1ZU3 A;  1GPT A;  2KBK A;  1C55 A;  1LQQ A;  2LI7 A;  2E3F A;  1ZFU A;  1C56 A;  1NH5 A;  1NRB A;  1I6F A;  2LKB A;  3E7U X;  2BRZ A;  1DQ7 A;  1NE5 A;  2B3C A;  1SNB A;  1ZYW A;  1TI5 A;  1I6G A;  1WMT A;  2NY8 X;  5CY0 A;  2KGQ A;  1BRZ A;  4AAZ A;  1I2V A;  1LQI A;  1B3C A;  1JZA A;  1BK8 A;  1OZZ A;  1FH3 A;  1ICA A;  1BMR A;  1SN4 A;  2LJM A;  1T7B A;  2N66 A;  3E7R L;  2KSK A;  2E3G A;  2YEO A;  1NRA A;  1T1T A;  2LY5 A;  1CN2 A;  1DJT A;  2KBH A;  1CHZ A;  2GL1 A;  4UJ0 A;  4HE7 A;  2YC1 C;  4V1D C;  1AYJ A;  2KBJ A;  4HHF A;  1PTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...