1ZVGA

Crystal structure of mutant k8dp9s of scorpion alpha-like neurotoxin bmk m1 from buthus martensii karsch
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
NSVRDAYIADSHNCVYECARNEYCNDLCTKNGAKSGYCQWVGKYGNGCWCIELPDNVPIRVPGKCH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-like neurotoxin BmK-I
publication title Structural basis for the voltage-gated Na+ channel selectivity of the scorpion alpha-like toxin BmK M1
pubmed doi rcsb
source organism Mesobuthus martensii
molecule tags Toxin
total genus 17
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2005-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1zvgA00
1NH5A 2LY5A 1SNBA 3E7UX 1I6GA 1JKZA 1AYJA 2KBHA 1WT7A 1OZZA 1ZUTA 2E0HA 4KYPA 2KJAA 1ZVGA 1BRZA 1KV0A 1PTXA 2LR3A 1N4NA 1C55A 2LT8A 2B3CA 1SEGA 3PSMA 1ZVEA 2M8BB 1CHZA 1ZFUA 2YC1C 2GL1A 1ZYWA 1CN2A 4AB0A 1JZBA 1B7DA 5CY0A 1PX9A 2A7TA 1I2VA 2KGQA 1PE4A 1T7EA 1T7BA 5KK4A 2N2RA 2SN3A 2KPYA 1AHOA 2MZ0A 1DQ7A 1MR4A 2E3FA 3E7RL 1T1TA 1BCGA 1T7AA 1VNAA 2ATBA 1GPSA 1TI5A 2KBJA 4CQKA 4AAZA 1I2UA 1FH3A 1OMYA 1WMTA 2LKBA 2YBRC 2N2QA 2NY9X 1NE5A 2LJ7A 1I6FA 1LQIA 2LI7A 2YEOA 1VNBA 2BRZA 1B3CA 1WWNA 2LJMA 4UJ0A 1JXCA 2KYQA 2NY8X 1C56A 1NRAA 2LY6A 4HE7A 1DJTA 1ICAA 1NRBA 1SN4A 1P00A 1LQQA 1LQHA 1SN1A 4AEIA 1BK8A 4HHFA 1BMRA 2B68A 1L4VA 2I61A 2KBKA 1JZAA 2E3GA 1GPTA 1P0AA 2N66A 1ZU3A 1ZYVA 2N69A 1NPIA 2KSKA 1T0ZA 1MYNA 4V1DC 2ASCA
chains in the Genus database with same CATH superfamily
1NH5A 3LDQA 1BUPA 3KHWA 1K8BA 2E88A 4GNIA 2LY5A 1SNBA 3E7UX 4FL9A 3QFUA 1JKZA 1NGEA 1I6GA 1AYJA 2QWPA 3FZMA 3GKUA 2KBHA 5AQOA 3AY9A 3CW4A 1WT7A 5AQQA 5BN8A 2QWQA 3LDNA 3QMLA 3L4IA 1OZZA 5AQYA 2QW9A 2E2FA 2MN5A 5AQUA 1ZUTA 1KAZA 2E0HA 4KYPA 2KJAA 1ZVGA 2QXLA 3FZKA 3KP0A 1BRZA 1KV0A 1PTXA 1N4NA 2LR3A 1C55A 1UGLA 2LT8A 1NGGA 1NGDA 2B3CA 2YILA 3QFPA 1SEGA 3PSMA 1ZVEA 5F1XA 2M8BB 4HWIA 1CHZA 1YUWA 3BK3C 3KOYA 1ZFUA 2YC1C 2GL1A 1ZYWA 1CN2A 5AQIA 3D2FB 4AB0A 3M3ZA 3L6QA 1JZBA 4UADE 4UAEF 2QWRA 1B7DA 3FZFA 3FZHA 4H5NA 5BPMA 1PX9A 5CY0A 1QQNA 2A7TA 1NGHA 3D2FA 5EXWA 1XRSB 2QWMA 4H5WA 1HX1A 2YIPA 5AQMA 5AQWA 1I2VA 2KGQA 1PE4A 1T7EA 3KP1A 1T7BA 3D2EB 4H5VA 2N2RA 3GDQA 1QQOA 5KK4A 1BA1A 2SN3A 2KPYA 1AHOA 2QWOA 1DKGD 2MZ0A 3ATUA 1DQ7A 3D2EA 5FPEA 5F0XA 5BPLA 3JXUA 1MR4A 3C7NB 3LDLA 2E3FA 3E7RL 1T1TA 1BCGA 1T7AA 1VNAA 2ATBA 2QWLA 3KC6A 3KVGA 1GPSA 1HPMA 3LDOA 3A8YA 3ATVA 2E8AA 5EY4A 1TI5A 2BUPA 5AQSA 2KBJA 3FZLA 5AR0A 3R2VA 4CQKA 1QQMA 4AAZA 1I2UA 1FH3A 1NGBA 5AQZA 1OMYA 1NGCA 1WMTA 2LKBA 2YBRC 3KOWA 5AQHA 2N2QA 1ATSA 2NY9X 5AQRA 1NE5A 5AQVA 2V7ZA 2LJ7A 5FPNA 1I6FA 5AQFA 2QWNA 1LQIA 2LI7A 5AQGA 2YEOA 1VNBA 1NGAA 2G2KA 3KOZA 2BRZA 1B3CA 1WWNA 2LJMA 5AQJA 3SF4D 4UJ0A 1JXCA 4KBOA 3QI7A 2KYQA 5AQLA 2NY8X 5FPMA 4IO8A 1C56A 1POIA 5BPNA 1NRAA 2LY6A 3C7NA 1DJTA 4HE7A 5FPDA 1ICAA 3LDPA 1NRBA 1S3XA 3GL1A 1SN4A 3FE1A 1P00A 1LQQA 2YIOA 1LQHA 2KHOA 1SN1A 3L56A 2K35A 4AEIA 1BK8A 3KOXA 4H5TA 4HHFA 3I33A 1BMRA 2B68A 5F2RA 2GMOA 1ATRA 2MBKA 5EX5A 1L4VA 2I61A 1BA0A 2KBKA 1JZAA 1NGJA 2E3GA 2VY6A 1P0AA 2N66A 3IUCA 1ZU3A 2JDQD 5AQTA 4H5RA 1GPTA 1ZYVA 5AQKA 3HSCA 5AQNA 2N69A 1NGFA 4UAFE 5EVZA 3CQXA 1NGIA 1NPIA 2KSKA 2LN8A 4FSVA 1T0ZA 5AQPA 2D56A 1HJOA 1KAYA 1MYNA 4V1DC 5BN9A 2ASCA 5AQXA 1KAXA
chains in the Genus database with same CATH topology
1NH5A 2LY5A 1SNBA 3E7UX 1I6GA 1JKZA 1AYJA 2KBHA 1WT7A 1OZZA 1ZUTA 2E0HA 4KYPA 2KJAA 1ZVGA 1BRZA 1KV0A 1PTXA 2LR3A 1N4NA 1C55A 2LT8A 2B3CA 1SEGA 3PSMA 1ZVEA 2M8BB 1CHZA 1ZFUA 2YC1C 2GL1A 1ZYWA 1CN2A 4AB0A 1JZBA 1B7DA 5CY0A 1PX9A 2A7TA 1I2VA 2KGQA 1PE4A 1T7EA 1T7BA 5KK4A 2N2RA 2SN3A 2KPYA 1AHOA 2MZ0A 1DQ7A 1MR4A 2E3FA 3E7RL 1T1TA 1BCGA 1T7AA 1VNAA 2ATBA 1GPSA 1TI5A 2KBJA 4CQKA 4AAZA 1I2UA 1FH3A 1OMYA 1WMTA 2LKBA 2YBRC 2N2QA 2NY9X 1NE5A 2LJ7A 1I6FA 1LQIA 2LI7A 2YEOA 1VNBA 2BRZA 1B3CA 1WWNA 2LJMA 4UJ0A 1JXCA 2KYQA 2NY8X 1C56A 1NRAA 2LY6A 4HE7A 1DJTA 1ICAA 1NRBA 1SN4A 1P00A 1LQQA 1LQHA 1SN1A 4AEIA 1BK8A 4HHFA 1BMRA 2B68A 1L4VA 2I61A 2KBKA 1JZAA 2E3GA 1GPTA 1P0AA 2N66A 1ZU3A 1ZYVA 2N69A 1NPIA 2KSKA 1T0ZA 1MYNA 4V1DC 2ASCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NH5 A;  2LY5 A;  1SNB A;  3E7U X;  1I6G A;  1JKZ A;  1AYJ A;  2KBH A;  1WT7 A;  1OZZ A;  1ZUT A;  2E0H A;  4KYP A;  2KJA A;  1ZVG A;  1BRZ A;  1KV0 A;  1PTX A;  2LR3 A;  1N4N A;  1C55 A;  2LT8 A;  2B3C A;  1SEG A;  3PSM A;  1ZVE A;  2M8B B;  1CHZ A;  1ZFU A;  2YC1 C;  2GL1 A;  1ZYW A;  1CN2 A;  4AB0 A;  1JZB A;  1B7D A;  5CY0 A;  1PX9 A;  2A7T A;  1I2V A;  2KGQ A;  1PE4 A;  1T7E A;  1T7B A;  5KK4 A;  2N2R A;  2SN3 A;  2KPY A;  1AHO A;  2MZ0 A;  1DQ7 A;  1MR4 A;  2E3F A;  3E7R L;  1T1T A;  1BCG A;  1T7A A;  1VNA A;  2ATB A;  1GPS A;  1TI5 A;  2KBJ A;  4CQK A;  4AAZ A;  1I2U A;  1FH3 A;  1OMY A;  1WMT A;  2LKB A;  2YBR C;  2N2Q A;  2NY9 X;  1NE5 A;  2LJ7 A;  1I6F A;  1LQI A;  2LI7 A;  2YEO A;  1VNB A;  2BRZ A;  1B3C A;  1WWN A;  2LJM A;  4UJ0 A;  1JXC A;  2KYQ A;  2NY8 X;  1C56 A;  1NRA A;  2LY6 A;  4HE7 A;  1DJT A;  1ICA A;  1NRB A;  1SN4 A;  1P00 A;  1LQQ A;  1LQH A;  1SN1 A;  4AEI A;  1BK8 A;  4HHF A;  1BMR A;  2B68 A;  1L4V A;  2I61 A;  2KBK A;  1JZA A;  2E3G A;  1GPT A;  1P0A A;  2N66 A;  1ZU3 A;  1ZYV A;  2N69 A;  1NPI A;  2KSK A;  1T0Z A;  1MYN A;  4V1D C;  2ASC A; 
#chains in the Genus database with same CATH topology
 1NH5 A;  3LDQ A;  1BUP A;  3KHW A;  1K8B A;  2E88 A;  4GNI A;  2LY5 A;  1SNB A;  3E7U X;  4FL9 A;  3QFU A;  1JKZ A;  1NGE A;  1I6G A;  1AYJ A;  2QWP A;  3FZM A;  3GKU A;  2KBH A;  5AQO A;  3AY9 A;  3CW4 A;  1WT7 A;  5AQQ A;  5BN8 A;  2QWQ A;  3LDN A;  3QML A;  3L4I A;  1OZZ A;  5AQY A;  2QW9 A;  2E2F A;  2MN5 A;  5AQU A;  1ZUT A;  1KAZ A;  2E0H A;  4KYP A;  2KJA A;  1ZVG A;  2QXL A;  3FZK A;  3KP0 A;  1BRZ A;  1KV0 A;  1PTX A;  1N4N A;  2LR3 A;  1C55 A;  1UGL A;  2LT8 A;  1NGG A;  1NGD A;  2B3C A;  2YIL A;  3QFP A;  1SEG A;  3PSM A;  1ZVE A;  5F1X A;  2M8B B;  4HWI A;  1CHZ A;  1YUW A;  3BK3 C;  3KOY A;  1ZFU A;  2YC1 C;  2GL1 A;  1ZYW A;  1CN2 A;  5AQI A;  3D2F B;  4AB0 A;  3M3Z A;  3L6Q A;  1JZB A;  4UAD E;  4UAE F;  2QWR A;  1B7D A;  3FZF A;  3FZH A;  4H5N A;  5BPM A;  1PX9 A;  5CY0 A;  1QQN A;  2A7T A;  1NGH A;  3D2F A;  5EXW A;  1XRS B;  2QWM A;  4H5W A;  1HX1 A;  2YIP A;  5AQM A;  5AQW A;  1I2V A;  2KGQ A;  1PE4 A;  1T7E A;  3KP1 A;  1T7B A;  3D2E B;  4H5V A;  2N2R A;  3GDQ A;  1QQO A;  5KK4 A;  1BA1 A;  2SN3 A;  2KPY A;  1AHO A;  2QWO A;  1DKG D;  2MZ0 A;  3ATU A;  1DQ7 A;  3D2E A;  5FPE A;  5F0X A;  5BPL A;  3JXU A;  1MR4 A;  3C7N B;  3LDL A;  2E3F A;  3E7R L;  1T1T A;  1BCG A;  1T7A A;  1VNA A;  2ATB A;  2QWL A;  3KC6 A;  3KVG A;  1GPS A;  1HPM A;  3LDO A;  3A8Y A;  3ATV A;  2E8A A;  5EY4 A;  1TI5 A;  2BUP A;  5AQS A;  2KBJ A;  3FZL A;  5AR0 A;  3R2V A;  4CQK A;  1QQM A;  4AAZ A;  1I2U A;  1FH3 A;  1NGB A;  5AQZ A;  1OMY A;  1NGC A;  1WMT A;  2LKB A;  2YBR C;  3KOW A;  5AQH A;  2N2Q A;  1ATS A;  2NY9 X;  5AQR A;  1NE5 A;  5AQV A;  2V7Z A;  2LJ7 A;  5FPN A;  1I6F A;  5AQF A;  2QWN A;  1LQI A;  2LI7 A;  5AQG A;  2YEO A;  1VNB A;  1NGA A;  2G2K A;  3KOZ A;  2BRZ A;  1B3C A;  1WWN A;  2LJM A;  5AQJ A;  3SF4 D;  4UJ0 A;  1JXC A;  4KBO A;  3QI7 A;  2KYQ A;  5AQL A;  2NY8 X;  5FPM A;  4IO8 A;  1C56 A;  1POI A;  5BPN A;  1NRA A;  2LY6 A;  3C7N A;  1DJT A;  4HE7 A;  5FPD A;  1ICA A;  3LDP A;  1NRB A;  1S3X A;  3GL1 A;  1SN4 A;  3FE1 A;  1P00 A;  1LQQ A;  2YIO A;  1LQH A;  2KHO A;  1SN1 A;  3L56 A;  2K35 A;  4AEI A;  1BK8 A;  3KOX A;  4H5T A;  4HHF A;  3I33 A;  1BMR A;  2B68 A;  5F2R A;  2GMO A;  1ATR A;  2MBK A;  5EX5 A;  1L4V A;  2I61 A;  1BA0 A;  2KBK A;  1JZA A;  1NGJ A;  2E3G A;  2VY6 A;  1P0A A;  2N66 A;  3IUC A;  1ZU3 A;  2JDQ D;  5AQT A;  4H5R A;  1GPT A;  1ZYV A;  5AQK A;  3HSC A;  5AQN A;  2N69 A;  1NGF A;  4UAF E;  5EVZ A;  3CQX A;  1NGI A;  1NPI A;  2KSK A;  2LN8 A;  4FSV A;  1T0Z A;  5AQP A;  2D56 A;  1HJO A;  1KAY A;  1MYN A;  4V1D C;  5BN9 A;  2ASC A;  5AQX A;  1KAX A; 
#chains in the Genus database with same CATH homology
 1NH5 A;  2LY5 A;  1SNB A;  3E7U X;  1I6G A;  1JKZ A;  1AYJ A;  2KBH A;  1WT7 A;  1OZZ A;  1ZUT A;  2E0H A;  4KYP A;  2KJA A;  1ZVG A;  1BRZ A;  1KV0 A;  1PTX A;  2LR3 A;  1N4N A;  1C55 A;  2LT8 A;  2B3C A;  1SEG A;  3PSM A;  1ZVE A;  2M8B B;  1CHZ A;  1ZFU A;  2YC1 C;  2GL1 A;  1ZYW A;  1CN2 A;  4AB0 A;  1JZB A;  1B7D A;  5CY0 A;  1PX9 A;  2A7T A;  1I2V A;  2KGQ A;  1PE4 A;  1T7E A;  1T7B A;  5KK4 A;  2N2R A;  2SN3 A;  2KPY A;  1AHO A;  2MZ0 A;  1DQ7 A;  1MR4 A;  2E3F A;  3E7R L;  1T1T A;  1BCG A;  1T7A A;  1VNA A;  2ATB A;  1GPS A;  1TI5 A;  2KBJ A;  4CQK A;  4AAZ A;  1I2U A;  1FH3 A;  1OMY A;  1WMT A;  2LKB A;  2YBR C;  2N2Q A;  2NY9 X;  1NE5 A;  2LJ7 A;  1I6F A;  1LQI A;  2LI7 A;  2YEO A;  1VNB A;  2BRZ A;  1B3C A;  1WWN A;  2LJM A;  4UJ0 A;  1JXC A;  2KYQ A;  2NY8 X;  1C56 A;  1NRA A;  2LY6 A;  4HE7 A;  1DJT A;  1ICA A;  1NRB A;  1SN4 A;  1P00 A;  1LQQ A;  1LQH A;  1SN1 A;  4AEI A;  1BK8 A;  4HHF A;  1BMR A;  2B68 A;  1L4V A;  2I61 A;  2KBK A;  1JZA A;  2E3G A;  1GPT A;  1P0A A;  2N66 A;  1ZU3 A;  1ZYV A;  2N69 A;  1NPI A;  2KSK A;  1T0Z A;  1MYN A;  4V1D C;  2ASC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...