2KPYA

Solution structure of the major allergen of artemisia vulgaris (art v 1)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
108
structure length
108
Chain Sequence
AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major pollen allergen Art v 1
publication title Mapping the interactions between a major pollen allergen and human IgE antibodies.
pubmed doi rcsb
source organism Artemisia vulgaris
molecule tags Allergen
total genus 7
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2kpyA01
2N66A 2MZ0A 1DQ7A 2A7TA 4CQKA 1WT7A 2M8BB 1AYJA 2KYQA 2B3CA 2KBKA 1T7EA 1ZYWA 2N2QA 1T7BA 1LQHA 1T1TA 1ICAA 5CY0A 1NRBA 1SN1A 1NRAA 2I61A 4V1DC 2LY6A 4KYPA 1B3CA 1PX9A 3E7UX 1DJTA 1B7DA 2KJAA 4HE7A 2B68A 2GL1A 1SEGA 2SN3A 1JZAA 1BCGA 1SN4A 2N2RA 2KGQA 1CHZA 4AEIA 1P0AA 4AB0A 1NH5A 1I2VA 1I6FA 1VNBA 1L4VA 1KV0A 1TI5A 1BK8A 2NY8X 1PE4A 1P00A 1I6GA 1T0ZA 2KPYA 2LJ7A 1PTXA 1LQQA 1JXCA 2KBHA 1JKZA 1GPTA 2E0HA 2YBRC 2KBJA 1CN2A 1ZUTA 1GPSA 1WWNA 2BRZA 1MR4A 2LI7A 2NY9X 1NE5A 4AAZA 1ZU3A 5KK4A 2LY5A 1ZYVA 1OMYA 2E3GA 3E7RL 2LT8A 2KSKA 1NPIA 1BRZA 1C55A 2ASCA 4UJ0A 2N69A 1JZBA 1FH3A 1ZVGA 2YC1C 1BMRA 1ZVEA 1SNBA 2LKBA 1LQIA 2E3FA 1OZZA 2ATBA 1AHOA 1WMTA 1C56A 1VNAA 1ZFUA 1N4NA 4HHFA 1I2UA 2YEOA 1T7AA 2LJMA 3PSMA 1MYNA 2LR3A
chains in the Genus database with same CATH superfamily
3KOXA 2N66A 2MZ0A 1S3XA 1DQ7A 2A7TA 1UGLA 1WT7A 5EVZA 5F2RA 4CQKA 2M8BB 2VY6A 1AYJA 2KYQA 2YILA 2KHOA 4FSVA 2B3CA 2KBKA 1T7EA 3GL1A 5AQZA 1ZYWA 1YUWA 2N2QA 3LDNA 1T7BA 3IUCA 1LQHA 1T1TA 5AQXA 5FPMA 2K35A 3D2EB 2GMOA 1ICAA 3BK3C 5CY0A 1QQMA 4H5NA 1NRBA 1SN1A 5AQFA 3GKUA 4GNIA 1NRAA 2I61A 1QQOA 1XRSB 3LDOA 4V1DC 1NGDA 5AQUA 5AQWA 2LY6A 4KYPA 1B3CA 1PX9A 5AQMA 3E7UX 5FPNA 4H5WA 3L56A 1DJTA 2E8AA 1B7DA 5BN9A 2KJAA 4HE7A 2B68A 2GL1A 2G2KA 5F0XA 3KC6A 3GDQA 3LDLA 5AQNA 1SEGA 5AQVA 2SN3A 5AQGA 2JDQD 3D2EA 1JZAA 2QWPA 3LDQA 5AQKA 1BCGA 5AR0A 1SN4A 2N2RA 2KGQA 2QWOA 2QWQA 1CHZA 5AQYA 4AEIA 2V7ZA 2E2FA 1KAZA 1NGEA 4H5VA 3M3ZA 3FZFA 3KOZA 5EY4A 1P0AA 3SF4D 1K8BA 4AB0A 3CQXA 4H5TA 1NH5A 3JXUA 1I6FA 2QWNA 1I2VA 5AQTA 1VNBA 3AY9A 1L4VA 1KV0A 3KOWA 1NGJA 3HSCA 1QQNA 1HX1A 1TI5A 1KAYA 2E88A 2QXLA 3I33A 1BK8A 3FZHA 4UAEF 2NY8X 1PE4A 3D2FA 1NGGA 1P00A 1POIA 4HWIA 4UAFE 1KAXA 1I6GA 1T0ZA 2MN5A 2KPYA 3C7NB 2LJ7A 1BA0A 1BUPA 1PTXA 3D2FB 3QI7A 2QWRA 5BPLA 5BPMA 1LQQA 1JXCA 2KBHA 3A8YA 5EX5A 3FZMA 1JKZA 2E0HA 2YBRC 1GPTA 2KBJA 3KVGA 1DKGD 1BA1A 1CN2A 1ZUTA 1GPSA 1ATRA 2YIPA 2BUPA 1WWNA 2BRZA 1MR4A 2LI7A 1ATSA 3L4IA 2NY9X 2QWLA 1NE5A 4UADE 5AQLA 5AQRA 4AAZA 1ZU3A 5FPEA 3FZKA 2QWMA 4IO8A 3C7NA 1HPMA 5KK4A 5FPDA 3L6QA 3QMLA 2LY5A 4KBOA 1ZYVA 1NGBA 1OMYA 2E3GA 3E7RL 2LN8A 2LT8A 5AQOA 2KSKA 1NPIA 1BRZA 3KP0A 3FZLA 3FE1A 2QW9A 3CW4A 1NGHA 1NGCA 1C55A 5AQQA 5BN8A 5AQHA 2ASCA 2YIOA 4UJ0A 1NGFA 2N69A 1JZBA 3QFPA 1FH3A 3KHWA 2MBKA 1ZVGA 2YC1C 3LDPA 1BMRA 4FL9A 5AQIA 1ZVEA 5BPNA 1NGIA 1NGAA 1SNBA 5F1XA 2LKBA 1LQIA 1OZZA 2E3FA 2ATBA 1AHOA 1HJOA 1WMTA 3KP1A 5AQJA 1ZFUA 1C56A 1VNAA 1N4NA 3QFUA 2D56A 4HHFA 1I2UA 5AQSA 3ATVA 2YEOA 5AQPA 3KOYA 4H5RA 3R2VA 1T7AA 2LJMA 3PSMA 5EXWA 1MYNA 2LR3A 3ATUA
chains in the Genus database with same CATH topology
2N66A 2MZ0A 1DQ7A 2A7TA 4CQKA 1WT7A 2M8BB 1AYJA 2KYQA 2B3CA 2KBKA 1T7EA 1ZYWA 2N2QA 1T7BA 1LQHA 1T1TA 1ICAA 5CY0A 1NRBA 1SN1A 1NRAA 2I61A 4V1DC 2LY6A 4KYPA 1B3CA 1PX9A 3E7UX 1DJTA 1B7DA 2KJAA 4HE7A 2B68A 2GL1A 1SEGA 2SN3A 1JZAA 1BCGA 1SN4A 2N2RA 2KGQA 1CHZA 4AEIA 1P0AA 4AB0A 1NH5A 1I2VA 1I6FA 1VNBA 1L4VA 1KV0A 1TI5A 1BK8A 2NY8X 1PE4A 1P00A 1I6GA 1T0ZA 2KPYA 2LJ7A 1PTXA 1LQQA 1JXCA 2KBHA 1JKZA 1GPTA 2E0HA 2YBRC 2KBJA 1CN2A 1ZUTA 1GPSA 1WWNA 2BRZA 1MR4A 2LI7A 2NY9X 1NE5A 4AAZA 1ZU3A 5KK4A 2LY5A 1ZYVA 1OMYA 2E3GA 3E7RL 2LT8A 2KSKA 1NPIA 1BRZA 1C55A 2ASCA 4UJ0A 2N69A 1JZBA 1FH3A 1ZVGA 2YC1C 1BMRA 1ZVEA 1SNBA 2LKBA 1LQIA 2E3FA 1OZZA 2ATBA 1AHOA 1WMTA 1C56A 1VNAA 1ZFUA 1N4NA 4HHFA 1I2UA 2YEOA 1T7AA 2LJMA 3PSMA 1MYNA 2LR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N66 A;  2MZ0 A;  1DQ7 A;  2A7T A;  4CQK A;  1WT7 A;  2M8B B;  1AYJ A;  2KYQ A;  2B3C A;  2KBK A;  1T7E A;  1ZYW A;  2N2Q A;  1T7B A;  1LQH A;  1T1T A;  1ICA A;  5CY0 A;  1NRB A;  1SN1 A;  1NRA A;  2I61 A;  4V1D C;  2LY6 A;  4KYP A;  1B3C A;  1PX9 A;  3E7U X;  1DJT A;  1B7D A;  2KJA A;  4HE7 A;  2B68 A;  2GL1 A;  1SEG A;  2SN3 A;  1JZA A;  1BCG A;  1SN4 A;  2N2R A;  2KGQ A;  1CHZ A;  4AEI A;  1P0A A;  4AB0 A;  1NH5 A;  1I2V A;  1I6F A;  1VNB A;  1L4V A;  1KV0 A;  1TI5 A;  1BK8 A;  2NY8 X;  1PE4 A;  1P00 A;  1I6G A;  1T0Z A;  2KPY A;  2LJ7 A;  1PTX A;  1LQQ A;  1JXC A;  2KBH A;  1JKZ A;  1GPT A;  2E0H A;  2YBR C;  2KBJ A;  1CN2 A;  1ZUT A;  1GPS A;  1WWN A;  2BRZ A;  1MR4 A;  2LI7 A;  2NY9 X;  1NE5 A;  4AAZ A;  1ZU3 A;  5KK4 A;  2LY5 A;  1ZYV A;  1OMY A;  2E3G A;  3E7R L;  2LT8 A;  2KSK A;  1NPI A;  1BRZ A;  1C55 A;  2ASC A;  4UJ0 A;  2N69 A;  1JZB A;  1FH3 A;  1ZVG A;  2YC1 C;  1BMR A;  1ZVE A;  1SNB A;  2LKB A;  1LQI A;  2E3F A;  1OZZ A;  2ATB A;  1AHO A;  1WMT A;  1C56 A;  1VNA A;  1ZFU A;  1N4N A;  4HHF A;  1I2U A;  2YEO A;  1T7A A;  2LJM A;  3PSM A;  1MYN A;  2LR3 A; 
#chains in the Genus database with same CATH topology
 3KOX A;  2N66 A;  2MZ0 A;  1S3X A;  1DQ7 A;  2A7T A;  1UGL A;  1WT7 A;  5EVZ A;  5F2R A;  4CQK A;  2M8B B;  2VY6 A;  1AYJ A;  2KYQ A;  2YIL A;  2KHO A;  4FSV A;  2B3C A;  2KBK A;  1T7E A;  3GL1 A;  5AQZ A;  1ZYW A;  1YUW A;  2N2Q A;  3LDN A;  1T7B A;  3IUC A;  1LQH A;  1T1T A;  5AQX A;  5FPM A;  2K35 A;  3D2E B;  2GMO A;  1ICA A;  3BK3 C;  5CY0 A;  1QQM A;  4H5N A;  1NRB A;  1SN1 A;  5AQF A;  3GKU A;  4GNI A;  1NRA A;  2I61 A;  1QQO A;  1XRS B;  3LDO A;  4V1D C;  1NGD A;  5AQU A;  5AQW A;  2LY6 A;  4KYP A;  1B3C A;  1PX9 A;  5AQM A;  3E7U X;  5FPN A;  4H5W A;  3L56 A;  1DJT A;  2E8A A;  1B7D A;  5BN9 A;  2KJA A;  4HE7 A;  2B68 A;  2GL1 A;  2G2K A;  5F0X A;  3KC6 A;  3GDQ A;  3LDL A;  5AQN A;  1SEG A;  5AQV A;  2SN3 A;  5AQG A;  2JDQ D;  3D2E A;  1JZA A;  2QWP A;  3LDQ A;  5AQK A;  1BCG A;  5AR0 A;  1SN4 A;  2N2R A;  2KGQ A;  2QWO A;  2QWQ A;  1CHZ A;  5AQY A;  4AEI A;  2V7Z A;  2E2F A;  1KAZ A;  1NGE A;  4H5V A;  3M3Z A;  3FZF A;  3KOZ A;  5EY4 A;  1P0A A;  3SF4 D;  1K8B A;  4AB0 A;  3CQX A;  4H5T A;  1NH5 A;  3JXU A;  1I6F A;  2QWN A;  1I2V A;  5AQT A;  1VNB A;  3AY9 A;  1L4V A;  1KV0 A;  3KOW A;  1NGJ A;  3HSC A;  1QQN A;  1HX1 A;  1TI5 A;  1KAY A;  2E88 A;  2QXL A;  3I33 A;  1BK8 A;  3FZH A;  4UAE F;  2NY8 X;  1PE4 A;  3D2F A;  1NGG A;  1P00 A;  1POI A;  4HWI A;  4UAF E;  1KAX A;  1I6G A;  1T0Z A;  2MN5 A;  2KPY A;  3C7N B;  2LJ7 A;  1BA0 A;  1BUP A;  1PTX A;  3D2F B;  3QI7 A;  2QWR A;  5BPL A;  5BPM A;  1LQQ A;  1JXC A;  2KBH A;  3A8Y A;  5EX5 A;  3FZM A;  1JKZ A;  2E0H A;  2YBR C;  1GPT A;  2KBJ A;  3KVG A;  1DKG D;  1BA1 A;  1CN2 A;  1ZUT A;  1GPS A;  1ATR A;  2YIP A;  2BUP A;  1WWN A;  2BRZ A;  1MR4 A;  2LI7 A;  1ATS A;  3L4I A;  2NY9 X;  2QWL A;  1NE5 A;  4UAD E;  5AQL A;  5AQR A;  4AAZ A;  1ZU3 A;  5FPE A;  3FZK A;  2QWM A;  4IO8 A;  3C7N A;  1HPM A;  5KK4 A;  5FPD A;  3L6Q A;  3QML A;  2LY5 A;  4KBO A;  1ZYV A;  1NGB A;  1OMY A;  2E3G A;  3E7R L;  2LN8 A;  2LT8 A;  5AQO A;  2KSK A;  1NPI A;  1BRZ A;  3KP0 A;  3FZL A;  3FE1 A;  2QW9 A;  3CW4 A;  1NGH A;  1NGC A;  1C55 A;  5AQQ A;  5BN8 A;  5AQH A;  2ASC A;  2YIO A;  4UJ0 A;  1NGF A;  2N69 A;  1JZB A;  3QFP A;  1FH3 A;  3KHW A;  2MBK A;  1ZVG A;  2YC1 C;  3LDP A;  1BMR A;  4FL9 A;  5AQI A;  1ZVE A;  5BPN A;  1NGI A;  1NGA A;  1SNB A;  5F1X A;  2LKB A;  1LQI A;  1OZZ A;  2E3F A;  2ATB A;  1AHO A;  1HJO A;  1WMT A;  3KP1 A;  5AQJ A;  1ZFU A;  1C56 A;  1VNA A;  1N4N A;  3QFU A;  2D56 A;  4HHF A;  1I2U A;  5AQS A;  3ATV A;  2YEO A;  5AQP A;  3KOY A;  4H5R A;  3R2V A;  1T7A A;  2LJM A;  3PSM A;  5EXW A;  1MYN A;  2LR3 A;  3ATU A; 
#chains in the Genus database with same CATH homology
 2N66 A;  2MZ0 A;  1DQ7 A;  2A7T A;  4CQK A;  1WT7 A;  2M8B B;  1AYJ A;  2KYQ A;  2B3C A;  2KBK A;  1T7E A;  1ZYW A;  2N2Q A;  1T7B A;  1LQH A;  1T1T A;  1ICA A;  5CY0 A;  1NRB A;  1SN1 A;  1NRA A;  2I61 A;  4V1D C;  2LY6 A;  4KYP A;  1B3C A;  1PX9 A;  3E7U X;  1DJT A;  1B7D A;  2KJA A;  4HE7 A;  2B68 A;  2GL1 A;  1SEG A;  2SN3 A;  1JZA A;  1BCG A;  1SN4 A;  2N2R A;  2KGQ A;  1CHZ A;  4AEI A;  1P0A A;  4AB0 A;  1NH5 A;  1I2V A;  1I6F A;  1VNB A;  1L4V A;  1KV0 A;  1TI5 A;  1BK8 A;  2NY8 X;  1PE4 A;  1P00 A;  1I6G A;  1T0Z A;  2KPY A;  2LJ7 A;  1PTX A;  1LQQ A;  1JXC A;  2KBH A;  1JKZ A;  1GPT A;  2E0H A;  2YBR C;  2KBJ A;  1CN2 A;  1ZUT A;  1GPS A;  1WWN A;  2BRZ A;  1MR4 A;  2LI7 A;  2NY9 X;  1NE5 A;  4AAZ A;  1ZU3 A;  5KK4 A;  2LY5 A;  1ZYV A;  1OMY A;  2E3G A;  3E7R L;  2LT8 A;  2KSK A;  1NPI A;  1BRZ A;  1C55 A;  2ASC A;  4UJ0 A;  2N69 A;  1JZB A;  1FH3 A;  1ZVG A;  2YC1 C;  1BMR A;  1ZVE A;  1SNB A;  2LKB A;  1LQI A;  2E3F A;  1OZZ A;  2ATB A;  1AHO A;  1WMT A;  1C56 A;  1VNA A;  1ZFU A;  1N4N A;  4HHF A;  1I2U A;  2YEO A;  1T7A A;  2LJM A;  3PSM A;  1MYN A;  2LR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...