2KPYA

Solution structure of the major allergen of artemisia vulgaris (art v 1)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
108
structure length
108
Chain Sequence
AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords Major pollen allergen Art v 1
publication title Mapping the interactions between a major pollen allergen and human IgE antibodies.
pubmed doi rcsb
source organism Artemisia vulgaris
total genus 7
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 2kpyA01
2E3FA 1LQQA 2ATBA 2KSKA 4UJ0A 1JZBA 2KJAA 1NPIA 1ICAA 1NRAA 1I6FA 1I6GA 1SNBA 2YEOA 2E3GA 2YBRC 2N66A 1DQ7A 2ASCA 1PTXA 2N2RA 1GPTA 1PE4A 1I2UA 4V1DC 1WMTA 1MR4A 1FH3A 1T0ZA 1CHZA 2LR3A 1BCGA 1AYJA 1NRBA 1BMRA 2NY8X 3E7RL 3PSMA 1VNAA 1VNBA 1ZYWA 2BRZA 1ZYVA 4HE7A 2NY9X 2KPYA 4AB0A 1C56A 2KBKA 2LKBA 1LQIA 1L4VA 2M8BB 1N4NA 1SN1A 2A7TA 1B7DA 4KYPA 1GPSA 1KV0A 1ZFUA 1BK8A 1SEGA 1T1TA 2LJ7A 1C55A 1JKZA 2KGQA 4AAZA 1OMYA 1I2VA 2KBHA 1SN4A 2LY6A 5CY0A 2KBJA 1ZVGA 1BRZA 4CQKA 1TI5A 2MZ0A 4AEIA 1WT7A 2LY5A 3E7UX 1B3CA 1JXCA 2LT8A 1T7EA 1DJTA 1WWNA 2B68A 1LQHA 2LJMA 1ZVEA 1T7AA 5KK4A 1P00A 1OZZA 2GL1A 1AHOA 4HHFA 2LI7A 1ZUTA 2I61A 2KYQA 2SN3A 1P0AA 2N2QA 2B3CA 2E0HA 2YC1C 1CN2A 1NH5A 1NE5A 1MYNA 1T7BA 1JZAA 1PX9A 1ZU3A 2N69A
chains in the Genus database with same CATH superfamily
2MBKA 3BK3C 3KVGA 2E3FA 1LQQA 2ATBA 2KSKA 1UGLA 2QWPA 3SF4D 3KP0A 4UJ0A 1KAYA 3GL1A 3KC6A 1K8BA 1JZBA 2KJAA 5AQSA 3HSCA 3CQXA 1NPIA 1XRSB 1BUPA 1NGBA 1QQOA 2D56A 3FZKA 5AQNA 5AQWA 3LDLA 2JDQD 3LDQA 5F2RA 1ICAA 1NRAA 5AQLA 2QW9A 3KHWA 2YILA 3KOZA 5FPNA 1I6FA 1I6GA 1HX1A 1SNBA 2YEOA 2E3GA 2YBRC 5AQUA 5BPLA 2N66A 2V7ZA 1DQ7A 2ASCA 1PTXA 5AQHA 5AQJA 3KOWA 2N2RA 5AQFA 4KBOA 2LN8A 3QI7A 4HWIA 5F0XA 5AQTA 3LDNA 1BA1A 1GPTA 1PE4A 3L56A 1I2UA 4V1DC 4FSVA 1KAZA 1WMTA 1MR4A 4GNIA 3FE1A 1DKGD 1T0ZA 2QWOA 1CHZA 2LR3A 3LDPA 1BCGA 5BN8A 1FH3A 1POIA 1AYJA 1NRBA 3LDOA 1BMRA 3C7NB 1NGAA 1ATRA 2NY8X 3E7RL 3PSMA 3QMLA 1VNAA 3FZLA 1VNBA 1ZYWA 3ATUA 5EY4A 2BRZA 4H5TA 1NGEA 1ZYVA 4HE7A 2NY9X 2KPYA 3QFUA 4AB0A 2QXLA 3D2EA 3L6QA 1C56A 5AQIA 1NGFA 2KBKA 2LKBA 4UAEF 5AQGA 1LQIA 1L4VA 5AQPA 1NGIA 1N4NA 1NGCA 1SN1A 2M8BB 2A7TA 3D2EB 2MN5A 4H5WA 1B7DA 1S3XA 5AQQA 4KYPA 3KOYA 2QWLA 4H5NA 1GPSA 1KV0A 1ZFUA 3QFPA 1BK8A 4UAFE 2KHOA 1SEGA 4H5RA 5BN9A 1T1TA 2LJ7A 2YIOA 2YIPA 5AQXA 1C55A 5FPEA 1JKZA 3C7NA 2KGQA 4AAZA 1OMYA 2E8AA 5AQRA 1I2VA 2KBHA 3FZHA 3GDQA 3IUCA 1HJOA 5AQOA 5EXWA 1SN4A 5F1XA 1QQMA 2LY6A 2VY6A 5AR0A 5CY0A 3GKUA 1NGDA 2KBJA 1ZVGA 3FZFA 5EX5A 1BRZA 4CQKA 5AQVA 4H5VA 2GMOA 1QQNA 1TI5A 5AQMA 2MZ0A 5BPMA 2BUPA 4AEIA 1WT7A 3R2VA 3KOXA 2LY5A 3E7UX 1B3CA 1JXCA 2LT8A 1T7EA 1DJTA 1WWNA 1NGGA 4FL9A 5BPNA 1KAXA 2B68A 5AQZA 4UADE 1LQHA 1ATSA 4IO8A 1BA0A 5FPMA 2LJMA 1ZVEA 3FZMA 1T7AA 5KK4A 3I33A 1P00A 3M3ZA 1OZZA 1NGHA 3ATVA 2GL1A 3JXUA 1AHOA 4HHFA 2LI7A 1NGJA 1ZUTA 2I61A 5FPDA 2G2KA 2KYQA 3L4IA 2E88A 2SN3A 1P0AA 2N2QA 2B3CA 3D2FA 1HPMA 5AQKA 2E0HA 2YC1C 2K35A 5AQYA 2QWQA 1CN2A 1NH5A 1NE5A 1YUWA 2E2FA 2QWNA 2QWRA 3A8YA 2QWMA 1MYNA 3KP1A 1T7BA 3D2FB 1JZAA 1PX9A 1ZU3A 3CW4A 5EVZA 2N69A 3AY9A
chains in the Genus database with same CATH topology
2E3FA 1LQQA 2ATBA 2KSKA 4UJ0A 1JZBA 2KJAA 1NPIA 1ICAA 1NRAA 1I6FA 1I6GA 1SNBA 2YEOA 2E3GA 2YBRC 2N66A 1DQ7A 2ASCA 1PTXA 2N2RA 1GPTA 1PE4A 1I2UA 4V1DC 1WMTA 1MR4A 1FH3A 1T0ZA 1CHZA 2LR3A 1BCGA 1AYJA 1NRBA 1BMRA 2NY8X 3E7RL 3PSMA 1VNAA 1VNBA 1ZYWA 2BRZA 1ZYVA 4HE7A 2NY9X 2KPYA 4AB0A 1C56A 2KBKA 2LKBA 1LQIA 1L4VA 2M8BB 1N4NA 1SN1A 2A7TA 1B7DA 4KYPA 1GPSA 1KV0A 1ZFUA 1BK8A 1SEGA 1T1TA 2LJ7A 1C55A 1JKZA 2KGQA 4AAZA 1OMYA 1I2VA 2KBHA 1SN4A 2LY6A 5CY0A 2KBJA 1ZVGA 1BRZA 4CQKA 1TI5A 2MZ0A 4AEIA 1WT7A 2LY5A 3E7UX 1B3CA 1JXCA 2LT8A 1T7EA 1DJTA 1WWNA 2B68A 1LQHA 2LJMA 1ZVEA 1T7AA 5KK4A 1P00A 1OZZA 2GL1A 1AHOA 4HHFA 2LI7A 1ZUTA 2I61A 2KYQA 2SN3A 1P0AA 2N2QA 2B3CA 2E0HA 2YC1C 1CN2A 1NH5A 1NE5A 1MYNA 1T7BA 1JZAA 1PX9A 1ZU3A 2N69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E3F A;  1LQQ A;  2ATB A;  2KSK A;  4UJ0 A;  1JZB A;  2KJA A;  1NPI A;  1ICA A;  1NRA A;  1I6F A;  1I6G A;  1SNB A;  2YEO A;  2E3G A;  2YBR C;  2N66 A;  1DQ7 A;  2ASC A;  1PTX A;  2N2R A;  1GPT A;  1PE4 A;  1I2U A;  4V1D C;  1WMT A;  1MR4 A;  1FH3 A;  1T0Z A;  1CHZ A;  2LR3 A;  1BCG A;  1AYJ A;  1NRB A;  1BMR A;  2NY8 X;  3E7R L;  3PSM A;  1VNA A;  1VNB A;  1ZYW A;  2BRZ A;  1ZYV A;  4HE7 A;  2NY9 X;  2KPY A;  4AB0 A;  1C56 A;  2KBK A;  2LKB A;  1LQI A;  1L4V A;  2M8B B;  1N4N A;  1SN1 A;  2A7T A;  1B7D A;  4KYP A;  1GPS A;  1KV0 A;  1ZFU A;  1BK8 A;  1SEG A;  1T1T A;  2LJ7 A;  1C55 A;  1JKZ A;  2KGQ A;  4AAZ A;  1OMY A;  1I2V A;  2KBH A;  1SN4 A;  2LY6 A;  5CY0 A;  2KBJ A;  1ZVG A;  1BRZ A;  4CQK A;  1TI5 A;  2MZ0 A;  4AEI A;  1WT7 A;  2LY5 A;  3E7U X;  1B3C A;  1JXC A;  2LT8 A;  1T7E A;  1DJT A;  1WWN A;  2B68 A;  1LQH A;  2LJM A;  1ZVE A;  1T7A A;  5KK4 A;  1P00 A;  1OZZ A;  2GL1 A;  1AHO A;  4HHF A;  2LI7 A;  1ZUT A;  2I61 A;  2KYQ A;  2SN3 A;  1P0A A;  2N2Q A;  2B3C A;  2E0H A;  2YC1 C;  1CN2 A;  1NH5 A;  1NE5 A;  1MYN A;  1T7B A;  1JZA A;  1PX9 A;  1ZU3 A;  2N69 A; 
#chains in the Genus database with same CATH topology
 2MBK A;  3BK3 C;  3KVG A;  2E3F A;  1LQQ A;  2ATB A;  2KSK A;  1UGL A;  2QWP A;  3SF4 D;  3KP0 A;  4UJ0 A;  1KAY A;  3GL1 A;  3KC6 A;  1K8B A;  1JZB A;  2KJA A;  5AQS A;  3HSC A;  3CQX A;  1NPI A;  1XRS B;  1BUP A;  1NGB A;  1QQO A;  2D56 A;  3FZK A;  5AQN A;  5AQW A;  3LDL A;  2JDQ D;  3LDQ A;  5F2R A;  1ICA A;  1NRA A;  5AQL A;  2QW9 A;  3KHW A;  2YIL A;  3KOZ A;  5FPN A;  1I6F A;  1I6G A;  1HX1 A;  1SNB A;  2YEO A;  2E3G A;  2YBR C;  5AQU A;  5BPL A;  2N66 A;  2V7Z A;  1DQ7 A;  2ASC A;  1PTX A;  5AQH A;  5AQJ A;  3KOW A;  2N2R A;  5AQF A;  4KBO A;  2LN8 A;  3QI7 A;  4HWI A;  5F0X A;  5AQT A;  3LDN A;  1BA1 A;  1GPT A;  1PE4 A;  3L56 A;  1I2U A;  4V1D C;  4FSV A;  1KAZ A;  1WMT A;  1MR4 A;  4GNI A;  3FE1 A;  1DKG D;  1T0Z A;  2QWO A;  1CHZ A;  2LR3 A;  3LDP A;  1BCG A;  5BN8 A;  1FH3 A;  1POI A;  1AYJ A;  1NRB A;  3LDO A;  1BMR A;  3C7N B;  1NGA A;  1ATR A;  2NY8 X;  3E7R L;  3PSM A;  3QML A;  1VNA A;  3FZL A;  1VNB A;  1ZYW A;  3ATU A;  5EY4 A;  2BRZ A;  4H5T A;  1NGE A;  1ZYV A;  4HE7 A;  2NY9 X;  2KPY A;  3QFU A;  4AB0 A;  2QXL A;  3D2E A;  3L6Q A;  1C56 A;  5AQI A;  1NGF A;  2KBK A;  2LKB A;  4UAE F;  5AQG A;  1LQI A;  1L4V A;  5AQP A;  1NGI A;  1N4N A;  1NGC A;  1SN1 A;  2M8B B;  2A7T A;  3D2E B;  2MN5 A;  4H5W A;  1B7D A;  1S3X A;  5AQQ A;  4KYP A;  3KOY A;  2QWL A;  4H5N A;  1GPS A;  1KV0 A;  1ZFU A;  3QFP A;  1BK8 A;  4UAF E;  2KHO A;  1SEG A;  4H5R A;  5BN9 A;  1T1T A;  2LJ7 A;  2YIO A;  2YIP A;  5AQX A;  1C55 A;  5FPE A;  1JKZ A;  3C7N A;  2KGQ A;  4AAZ A;  1OMY A;  2E8A A;  5AQR A;  1I2V A;  2KBH A;  3FZH A;  3GDQ A;  3IUC A;  1HJO A;  5AQO A;  5EXW A;  1SN4 A;  5F1X A;  1QQM A;  2LY6 A;  2VY6 A;  5AR0 A;  5CY0 A;  3GKU A;  1NGD A;  2KBJ A;  1ZVG A;  3FZF A;  5EX5 A;  1BRZ A;  4CQK A;  5AQV A;  4H5V A;  2GMO A;  1QQN A;  1TI5 A;  5AQM A;  2MZ0 A;  5BPM A;  2BUP A;  4AEI A;  1WT7 A;  3R2V A;  3KOX A;  2LY5 A;  3E7U X;  1B3C A;  1JXC A;  2LT8 A;  1T7E A;  1DJT A;  1WWN A;  1NGG A;  4FL9 A;  5BPN A;  1KAX A;  2B68 A;  5AQZ A;  4UAD E;  1LQH A;  1ATS A;  4IO8 A;  1BA0 A;  5FPM A;  2LJM A;  1ZVE A;  3FZM A;  1T7A A;  5KK4 A;  3I33 A;  1P00 A;  3M3Z A;  1OZZ A;  1NGH A;  3ATV A;  2GL1 A;  3JXU A;  1AHO A;  4HHF A;  2LI7 A;  1NGJ A;  1ZUT A;  2I61 A;  5FPD A;  2G2K A;  2KYQ A;  3L4I A;  2E88 A;  2SN3 A;  1P0A A;  2N2Q A;  2B3C A;  3D2F A;  1HPM A;  5AQK A;  2E0H A;  2YC1 C;  2K35 A;  5AQY A;  2QWQ A;  1CN2 A;  1NH5 A;  1NE5 A;  1YUW A;  2E2F A;  2QWN A;  2QWR A;  3A8Y A;  2QWM A;  1MYN A;  3KP1 A;  1T7B A;  3D2F B;  1JZA A;  1PX9 A;  1ZU3 A;  3CW4 A;  5EVZ A;  2N69 A;  3AY9 A; 
#chains in the Genus database with same CATH homology
 2E3F A;  1LQQ A;  2ATB A;  2KSK A;  4UJ0 A;  1JZB A;  2KJA A;  1NPI A;  1ICA A;  1NRA A;  1I6F A;  1I6G A;  1SNB A;  2YEO A;  2E3G A;  2YBR C;  2N66 A;  1DQ7 A;  2ASC A;  1PTX A;  2N2R A;  1GPT A;  1PE4 A;  1I2U A;  4V1D C;  1WMT A;  1MR4 A;  1FH3 A;  1T0Z A;  1CHZ A;  2LR3 A;  1BCG A;  1AYJ A;  1NRB A;  1BMR A;  2NY8 X;  3E7R L;  3PSM A;  1VNA A;  1VNB A;  1ZYW A;  2BRZ A;  1ZYV A;  4HE7 A;  2NY9 X;  2KPY A;  4AB0 A;  1C56 A;  2KBK A;  2LKB A;  1LQI A;  1L4V A;  2M8B B;  1N4N A;  1SN1 A;  2A7T A;  1B7D A;  4KYP A;  1GPS A;  1KV0 A;  1ZFU A;  1BK8 A;  1SEG A;  1T1T A;  2LJ7 A;  1C55 A;  1JKZ A;  2KGQ A;  4AAZ A;  1OMY A;  1I2V A;  2KBH A;  1SN4 A;  2LY6 A;  5CY0 A;  2KBJ A;  1ZVG A;  1BRZ A;  4CQK A;  1TI5 A;  2MZ0 A;  4AEI A;  1WT7 A;  2LY5 A;  3E7U X;  1B3C A;  1JXC A;  2LT8 A;  1T7E A;  1DJT A;  1WWN A;  2B68 A;  1LQH A;  2LJM A;  1ZVE A;  1T7A A;  5KK4 A;  1P00 A;  1OZZ A;  2GL1 A;  1AHO A;  4HHF A;  2LI7 A;  1ZUT A;  2I61 A;  2KYQ A;  2SN3 A;  1P0A A;  2N2Q A;  2B3C A;  2E0H A;  2YC1 C;  1CN2 A;  1NH5 A;  1NE5 A;  1MYN A;  1T7B A;  1JZA A;  1PX9 A;  1ZU3 A;  2N69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...