1VNBA

Proton nuclear magnetic resonance and distance geometry(slash)simulated annealing studies on the variant-1 neurotoxin from the new world scorpion centruroides sculpturatus ewing
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
65
structure length
65
Chain Sequence
KEGYLVKKSDGCKYDCFWLGKNEHCNTECKAKNQGGSYGYCYAFACWCEGLPESTPTYPLPNKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROTOXIN
publication title Proton nuclear magnetic resonance and distance geometry/simulated annealing studies on the variant-1 neurotoxin from the New World scorpion Centruroides sculpturatus Ewing.
pubmed doi rcsb
source organism Centruroides sculpturatus
molecule tags Neurotoxin
total genus 5
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1vnbA00
2KGQA 1PTXA 4CQKA 1NPIA 1ZYVA 1WT7A 1JZBA 2KBKA 1ZUTA 2ATBA 1I2UA 1ICAA 2KJAA 2N2RA 4HHFA 1AHOA 1JKZA 2KYQA 2N69A 1LQIA 1T7EA 1SNBA 3PSMA 1NH5A 5CY0A 2KSKA 1LQQA 1JZAA 2B3CA 2LY5A 2N2QA 1OMYA 3E7RL 4HE7A 1ZFUA 1P0AA 2LI7A 2LR3A 1DQ7A 1AYJA 2I61A 2KBJA 2B68A 2E3FA 2A7TA 4UJ0A 2NY9X 2LJMA 2BRZA 1NRAA 1L4VA 1C55A 2YC1C 4KYPA 2M8BB 1BRZA 2N66A 1LQHA 1SEGA 1ZVGA 2ASCA 1BMRA 2E3GA 1GPSA 1T0ZA 2YBRC 1ZVEA 1I6FA 4AEIA 1MR4A 1I2VA 2KPYA 1N4NA 2SN3A 1I6GA 1T1TA 1PX9A 1B7DA 1VNAA 1OZZA 2E0HA 1FH3A 2LY6A 1P00A 1NRBA 1PE4A 2NY8X 1CN2A 1B3CA 1WWNA 2MZ0A 1ZYWA 1NE5A 4AB0A 2GL1A 2YEOA 1WMTA 1ZU3A 1KV0A 2KBHA 1DJTA 1C56A 2LT8A 1GPTA 1TI5A 1CHZA 4AAZA 1BK8A 1JXCA 1BCGA 2LJ7A 3E7UX 1SN1A 4V1DC 1SN4A 5KK4A 1T7AA 1T7BA 1MYNA 2LKBA 1VNBA
chains in the Genus database with same CATH superfamily
2KGQA 3GDQA 3C7NA 1PTXA 2JDQD 1NPIA 1ZYVA 4IO8A 1WT7A 4CQKA 1JZBA 1HJOA 3M3ZA 3ATVA 2KBKA 1ZUTA 2ATBA 3KOWA 5F1XA 5EXWA 3KP1A 4KBOA 5AR0A 3KC6A 5AQGA 2GMOA 3A8YA 4H5VA 2BUPA 5AQSA 1I2UA 1ICAA 4H5WA 2KJAA 1NGEA 2N2RA 2QWQA 3KOXA 3L4IA 4GNIA 3LDNA 5AQUA 4HHFA 1AHOA 1K8BA 1NGJA 1XRSB 1JKZA 2KYQA 3KHWA 2N69A 2QXLA 1LQIA 1T7EA 3IUCA 1SNBA 3PSMA 3KVGA 1NH5A 1ATSA 1S3XA 3KOZA 3HSCA 3ATUA 3FE1A 5CY0A 1HPMA 2KSKA 2K35A 5AQRA 1LQQA 2E2FA 5AQIA 5AQZA 3LDPA 2QWOA 5AQWA 1JZAA 4H5NA 2B3CA 2D56A 2G2KA 2LY5A 2N2QA 1OMYA 5F2RA 3QMLA 3E7RL 2QWRA 5BN9A 1NGAA 3GKUA 4HE7A 2QW9A 1ZFUA 1P0AA 2LI7A 3L56A 4UAFE 5EY4A 2LR3A 1DQ7A 1AYJA 2I61A 5AQFA 2KBJA 2B68A 2E3FA 4FSVA 5AQYA 2A7TA 5EX5A 4UJ0A 5AQMA 3QFUA 5AQPA 2NY9X 5BN8A 2LJMA 2BRZA 2LN8A 5FPDA 1DKGD 1NRAA 1L4VA 2E8AA 2E88A 5AQQA 3FZKA 2QWLA 5AQXA 2KHOA 1C55A 2YC1C 5AQJA 3AY9A 4KYPA 5AQLA 3D2FB 2M8BB 3LDOA 1BRZA 1UGLA 2N66A 1LQHA 2QWMA 5FPEA 1SEGA 3D2FA 1ZVGA 2ASCA 3CW4A 1KAXA 1NGIA 3D2EB 1BMRA 2E3GA 1NGGA 1GPSA 3D2EA 3KP0A 1HX1A 4UADE 2MBKA 5FPMA 1T0ZA 5F0XA 2YBRC 1ZVEA 5BPLA 1I6FA 5FPNA 4UAEF 3CQXA 3GL1A 1MR4A 3R2VA 4AEIA 1I2VA 3JXUA 2KPYA 1N4NA 2SN3A 3L6QA 1T1TA 3LDQA 1PX9A 1I6GA 1B7DA 1VNAA 1OZZA 2YIOA 2YIPA 2V7ZA 2E0HA 5AQNA 1FH3A 2LY6A 1P00A 5AQKA 1NRBA 1PE4A 4H5RA 5BPMA 2NY8X 1NGFA 1POIA 1BA1A 1CN2A 4FL9A 3C7NB 1QQNA 1WWNA 4H5TA 1B3CA 1QQOA 2MZ0A 1NGBA 1NE5A 1ZYWA 2GL1A 5AQVA 4AB0A 3QFPA 2YEOA 1WMTA 5AQTA 1ZU3A 1KV0A 2KBHA 1DJTA 1NGHA 1C56A 2LT8A 2YILA 5BPNA 2QWNA 2VY6A 1GPTA 1TI5A 3FZLA 3I33A 1CHZA 4AAZA 2MN5A 1BK8A 1JXCA 1BCGA 4HWIA 1KAZA 5AQHA 3LDLA 2LJ7A 3E7UX 1SN1A 4V1DC 5EVZA 1QQMA 3FZFA 5AQOA 1SN4A 1ATRA 3BK3C 5KK4A 3SF4D 1YUWA 1BUPA 1KAYA 3FZMA 1T7AA 1NGDA 1T7BA 1BA0A 2QWPA 1MYNA 1NGCA 3KOYA 2LKBA 1VNBA 3FZHA 3QI7A
chains in the Genus database with same CATH topology
2KGQA 1PTXA 4CQKA 1NPIA 1ZYVA 1WT7A 1JZBA 2KBKA 1ZUTA 2ATBA 1I2UA 1ICAA 2KJAA 2N2RA 4HHFA 1AHOA 1JKZA 2KYQA 2N69A 1LQIA 1T7EA 1SNBA 3PSMA 1NH5A 5CY0A 2KSKA 1LQQA 1JZAA 2B3CA 2LY5A 2N2QA 1OMYA 3E7RL 4HE7A 1ZFUA 1P0AA 2LI7A 2LR3A 1DQ7A 1AYJA 2I61A 2KBJA 2B68A 2E3FA 2A7TA 4UJ0A 2NY9X 2LJMA 2BRZA 1NRAA 1L4VA 1C55A 2YC1C 4KYPA 2M8BB 1BRZA 2N66A 1LQHA 1SEGA 1ZVGA 2ASCA 1BMRA 2E3GA 1GPSA 1T0ZA 2YBRC 1ZVEA 1I6FA 4AEIA 1MR4A 1I2VA 2KPYA 1N4NA 2SN3A 1I6GA 1T1TA 1PX9A 1B7DA 1VNAA 1OZZA 2E0HA 1FH3A 2LY6A 1P00A 1NRBA 1PE4A 2NY8X 1CN2A 1B3CA 1WWNA 2MZ0A 1ZYWA 1NE5A 4AB0A 2GL1A 2YEOA 1WMTA 1ZU3A 1KV0A 2KBHA 1DJTA 1C56A 2LT8A 1GPTA 1TI5A 1CHZA 4AAZA 1BK8A 1JXCA 1BCGA 2LJ7A 3E7UX 1SN1A 4V1DC 1SN4A 5KK4A 1T7AA 1T7BA 1MYNA 2LKBA 1VNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGQ A;  1PTX A;  4CQK A;  1NPI A;  1ZYV A;  1WT7 A;  1JZB A;  2KBK A;  1ZUT A;  2ATB A;  1I2U A;  1ICA A;  2KJA A;  2N2R A;  4HHF A;  1AHO A;  1JKZ A;  2KYQ A;  2N69 A;  1LQI A;  1T7E A;  1SNB A;  3PSM A;  1NH5 A;  5CY0 A;  2KSK A;  1LQQ A;  1JZA A;  2B3C A;  2LY5 A;  2N2Q A;  1OMY A;  3E7R L;  4HE7 A;  1ZFU A;  1P0A A;  2LI7 A;  2LR3 A;  1DQ7 A;  1AYJ A;  2I61 A;  2KBJ A;  2B68 A;  2E3F A;  2A7T A;  4UJ0 A;  2NY9 X;  2LJM A;  2BRZ A;  1NRA A;  1L4V A;  1C55 A;  2YC1 C;  4KYP A;  2M8B B;  1BRZ A;  2N66 A;  1LQH A;  1SEG A;  1ZVG A;  2ASC A;  1BMR A;  2E3G A;  1GPS A;  1T0Z A;  2YBR C;  1ZVE A;  1I6F A;  4AEI A;  1MR4 A;  1I2V A;  2KPY A;  1N4N A;  2SN3 A;  1I6G A;  1T1T A;  1PX9 A;  1B7D A;  1VNA A;  1OZZ A;  2E0H A;  1FH3 A;  2LY6 A;  1P00 A;  1NRB A;  1PE4 A;  2NY8 X;  1CN2 A;  1B3C A;  1WWN A;  2MZ0 A;  1ZYW A;  1NE5 A;  4AB0 A;  2GL1 A;  2YEO A;  1WMT A;  1ZU3 A;  1KV0 A;  2KBH A;  1DJT A;  1C56 A;  2LT8 A;  1GPT A;  1TI5 A;  1CHZ A;  4AAZ A;  1BK8 A;  1JXC A;  1BCG A;  2LJ7 A;  3E7U X;  1SN1 A;  4V1D C;  1SN4 A;  5KK4 A;  1T7A A;  1T7B A;  1MYN A;  2LKB A;  1VNB A; 
#chains in the Genus database with same CATH topology
 2KGQ A;  3GDQ A;  3C7N A;  1PTX A;  2JDQ D;  1NPI A;  1ZYV A;  4IO8 A;  1WT7 A;  4CQK A;  1JZB A;  1HJO A;  3M3Z A;  3ATV A;  2KBK A;  1ZUT A;  2ATB A;  3KOW A;  5F1X A;  5EXW A;  3KP1 A;  4KBO A;  5AR0 A;  3KC6 A;  5AQG A;  2GMO A;  3A8Y A;  4H5V A;  2BUP A;  5AQS A;  1I2U A;  1ICA A;  4H5W A;  2KJA A;  1NGE A;  2N2R A;  2QWQ A;  3KOX A;  3L4I A;  4GNI A;  3LDN A;  5AQU A;  4HHF A;  1AHO A;  1K8B A;  1NGJ A;  1XRS B;  1JKZ A;  2KYQ A;  3KHW A;  2N69 A;  2QXL A;  1LQI A;  1T7E A;  3IUC A;  1SNB A;  3PSM A;  3KVG A;  1NH5 A;  1ATS A;  1S3X A;  3KOZ A;  3HSC A;  3ATU A;  3FE1 A;  5CY0 A;  1HPM A;  2KSK A;  2K35 A;  5AQR A;  1LQQ A;  2E2F A;  5AQI A;  5AQZ A;  3LDP A;  2QWO A;  5AQW A;  1JZA A;  4H5N A;  2B3C A;  2D56 A;  2G2K A;  2LY5 A;  2N2Q A;  1OMY A;  5F2R A;  3QML A;  3E7R L;  2QWR A;  5BN9 A;  1NGA A;  3GKU A;  4HE7 A;  2QW9 A;  1ZFU A;  1P0A A;  2LI7 A;  3L56 A;  4UAF E;  5EY4 A;  2LR3 A;  1DQ7 A;  1AYJ A;  2I61 A;  5AQF A;  2KBJ A;  2B68 A;  2E3F A;  4FSV A;  5AQY A;  2A7T A;  5EX5 A;  4UJ0 A;  5AQM A;  3QFU A;  5AQP A;  2NY9 X;  5BN8 A;  2LJM A;  2BRZ A;  2LN8 A;  5FPD A;  1DKG D;  1NRA A;  1L4V A;  2E8A A;  2E88 A;  5AQQ A;  3FZK A;  2QWL A;  5AQX A;  2KHO A;  1C55 A;  2YC1 C;  5AQJ A;  3AY9 A;  4KYP A;  5AQL A;  3D2F B;  2M8B B;  3LDO A;  1BRZ A;  1UGL A;  2N66 A;  1LQH A;  2QWM A;  5FPE A;  1SEG A;  3D2F A;  1ZVG A;  2ASC A;  3CW4 A;  1KAX A;  1NGI A;  3D2E B;  1BMR A;  2E3G A;  1NGG A;  1GPS A;  3D2E A;  3KP0 A;  1HX1 A;  4UAD E;  2MBK A;  5FPM A;  1T0Z A;  5F0X A;  2YBR C;  1ZVE A;  5BPL A;  1I6F A;  5FPN A;  4UAE F;  3CQX A;  3GL1 A;  1MR4 A;  3R2V A;  4AEI A;  1I2V A;  3JXU A;  2KPY A;  1N4N A;  2SN3 A;  3L6Q A;  1T1T A;  3LDQ A;  1PX9 A;  1I6G A;  1B7D A;  1VNA A;  1OZZ A;  2YIO A;  2YIP A;  2V7Z A;  2E0H A;  5AQN A;  1FH3 A;  2LY6 A;  1P00 A;  5AQK A;  1NRB A;  1PE4 A;  4H5R A;  5BPM A;  2NY8 X;  1NGF A;  1POI A;  1BA1 A;  1CN2 A;  4FL9 A;  3C7N B;  1QQN A;  1WWN A;  4H5T A;  1B3C A;  1QQO A;  2MZ0 A;  1NGB A;  1NE5 A;  1ZYW A;  2GL1 A;  5AQV A;  4AB0 A;  3QFP A;  2YEO A;  1WMT A;  5AQT A;  1ZU3 A;  1KV0 A;  2KBH A;  1DJT A;  1NGH A;  1C56 A;  2LT8 A;  2YIL A;  5BPN A;  2QWN A;  2VY6 A;  1GPT A;  1TI5 A;  3FZL A;  3I33 A;  1CHZ A;  4AAZ A;  2MN5 A;  1BK8 A;  1JXC A;  1BCG A;  4HWI A;  1KAZ A;  5AQH A;  3LDL A;  2LJ7 A;  3E7U X;  1SN1 A;  4V1D C;  5EVZ A;  1QQM A;  3FZF A;  5AQO A;  1SN4 A;  1ATR A;  3BK3 C;  5KK4 A;  3SF4 D;  1YUW A;  1BUP A;  1KAY A;  3FZM A;  1T7A A;  1NGD A;  1T7B A;  1BA0 A;  2QWP A;  1MYN A;  1NGC A;  3KOY A;  2LKB A;  1VNB A;  3FZH A;  3QI7 A; 
#chains in the Genus database with same CATH homology
 2KGQ A;  1PTX A;  4CQK A;  1NPI A;  1ZYV A;  1WT7 A;  1JZB A;  2KBK A;  1ZUT A;  2ATB A;  1I2U A;  1ICA A;  2KJA A;  2N2R A;  4HHF A;  1AHO A;  1JKZ A;  2KYQ A;  2N69 A;  1LQI A;  1T7E A;  1SNB A;  3PSM A;  1NH5 A;  5CY0 A;  2KSK A;  1LQQ A;  1JZA A;  2B3C A;  2LY5 A;  2N2Q A;  1OMY A;  3E7R L;  4HE7 A;  1ZFU A;  1P0A A;  2LI7 A;  2LR3 A;  1DQ7 A;  1AYJ A;  2I61 A;  2KBJ A;  2B68 A;  2E3F A;  2A7T A;  4UJ0 A;  2NY9 X;  2LJM A;  2BRZ A;  1NRA A;  1L4V A;  1C55 A;  2YC1 C;  4KYP A;  2M8B B;  1BRZ A;  2N66 A;  1LQH A;  1SEG A;  1ZVG A;  2ASC A;  1BMR A;  2E3G A;  1GPS A;  1T0Z A;  2YBR C;  1ZVE A;  1I6F A;  4AEI A;  1MR4 A;  1I2V A;  2KPY A;  1N4N A;  2SN3 A;  1I6G A;  1T1T A;  1PX9 A;  1B7D A;  1VNA A;  1OZZ A;  2E0H A;  1FH3 A;  2LY6 A;  1P00 A;  1NRB A;  1PE4 A;  2NY8 X;  1CN2 A;  1B3C A;  1WWN A;  2MZ0 A;  1ZYW A;  1NE5 A;  4AB0 A;  2GL1 A;  2YEO A;  1WMT A;  1ZU3 A;  1KV0 A;  2KBH A;  1DJT A;  1C56 A;  2LT8 A;  1GPT A;  1TI5 A;  1CHZ A;  4AAZ A;  1BK8 A;  1JXC A;  1BCG A;  2LJ7 A;  3E7U X;  1SN1 A;  4V1D C;  1SN4 A;  5KK4 A;  1T7A A;  1T7B A;  1MYN A;  2LKB A;  1VNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...