1VNBA

Proton nuclear magnetic resonance and distance geometry(slash)simulated annealing studies on the variant-1 neurotoxin from the new world scorpion centruroides sculpturatus ewing
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
65
structure length
65
Chain Sequence
KEGYLVKKSDGCKYDCFWLGKNEHCNTECKAKNQGGSYGYCYAFACWCEGLPESTPTYPLPNKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Neurotoxin
molecule keywords NEUROTOXIN
publication title Proton nuclear magnetic resonance and distance geometry/simulated annealing studies on the variant-1 neurotoxin from the New World scorpion Centruroides sculpturatus Ewing.
pubmed doi rcsb
source organism Centruroides sculpturatus
total genus 5
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1993-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1vnbA00
1ZYWA 4HHFA 1L4VA 1B7DA 1CN2A 1ZVEA 2YEOA 1PTXA 1KV0A 2M8BB 1AHOA 1JKZA 1T7AA 2KGQA 1DQ7A 1PE4A 2KBKA 1TI5A 1I6GA 1JXCA 2KJAA 1NH5A 5KK4A 1BK8A 2LI7A 1ZVGA 2E3FA 4KYPA 1T1TA 2N2RA 1MR4A 1MYNA 1OMYA 1P00A 2SN3A 1I2UA 1I2VA 1SEGA 1VNAA 1N4NA 5CY0A 1SN4A 1ICAA 1GPSA 1BMRA 1JZAA 1WMTA 2KBHA 4UJ0A 2LJMA 1NPIA 1AYJA 2LJ7A 1ZYVA 2GL1A 2YBRC 2ASCA 1PX9A 2NY9X 1C55A 2KYQA 2N69A 2E0HA 2KBJA 4AAZA 1WWNA 2LY5A 2NY8X 1VNBA 2KSKA 1FH3A 1WT7A 1GPTA 1JZBA 1P0AA 1BCGA 2LY6A 2YC1C 1I6FA 1SN1A 4CQKA 1ZFUA 3PSMA 1OZZA 2A7TA 1ZU3A 1T0ZA 4V1DC 2I61A 2LKBA 2KPYA 1LQHA 1CHZA 1DJTA 1T7EA 2N2QA 1LQIA 2N66A 3E7RL 2LR3A 2B68A 4AB0A 2MZ0A 1NE5A 1C56A 1NRAA 2BRZA 1SNBA 2B3CA 3E7UX 1T7BA 4HE7A 1ZUTA 1B3CA 1LQQA 2E3GA 2ATBA 1NRBA 4AEIA 1BRZA 2LT8A
chains in the Genus database with same CATH superfamily
1YUWA 1ZYWA 4HHFA 5BPNA 1B7DA 5FPDA 5BN8A 1CN2A 1L4VA 1ZVEA 2YEOA 1PTXA 1DKGD 2QWQA 1KV0A 2M8BB 2E2FA 5EVZA 5F1XA 2QWRA 1AHOA 1K8BA 1JKZA 1T7AA 2KGQA 3KHWA 1NGJA 3FZLA 3LDNA 4H5VA 1DQ7A 1PE4A 5AQVA 3LDQA 3SF4D 2KBKA 2LN8A 1TI5A 1QQNA 5AQOA 3GDQA 4KBOA 3KOXA 1I6GA 5AQPA 1JXCA 3FZKA 5AQSA 1BA0A 2KJAA 2QWMA 3LDLA 1NH5A 5KK4A 1BK8A 2LI7A 5FPEA 1ZVGA 2E3FA 3KVGA 3R2VA 4KYPA 1T1TA 2N2RA 3ATVA 1MR4A 1MYNA 2QWPA 1OMYA 1P00A 2SN3A 3ATUA 3HSCA 3L4IA 1SEGA 4IO8A 1VNAA 5FPNA 1I2VA 4UAFE 1N4NA 3D2FA 3FZHA 5CY0A 3KP1A 1SN4A 1NGBA 1UGLA 2D56A 1XRSB 2MN5A 2K35A 3FE1A 3AY9A 3GKUA 4FL9A 4GNIA 5AQUA 1ICAA 1S3XA 3LDOA 1GPSA 2V7ZA 4H5TA 1JZAA 1WMTA 3KC6A 1BMRA 2KBHA 1KAXA 5AQKA 3QMLA 1BRZA 1HPMA 5AQNA 5AR0A 4UJ0A 2LJMA 5AQXA 5AQLA 5AQYA 1NPIA 3CQXA 1AYJA 2LJ7A 1ZYVA 2GL1A 2YBRC 2ASCA 1PX9A 3C7NB 1NGCA 2NY9X 2GMOA 2KYQA 2VY6A 1C55A 2N69A 3C7NA 2E0HA 5BPMA 2KBJA 2BUPA 1WWNA 4AAZA 5F0XA 2LY5A 3M3ZA 2NY8X 1I2UA 1VNBA 5AQHA 2KSKA 3D2FB 1BA1A 3LDPA 1FH3A 3I33A 3A8YA 3D2EB 5AQFA 1WT7A 1NGAA 1GPTA 1KAYA 3D2EA 1NGGA 3QI7A 3IUCA 1JZBA 5AQQA 1P0AA 5EXWA 2QXLA 1BCGA 2LY6A 1NGEA 2YC1C 3QFPA 5AQMA 2JDQD 2QWNA 1I6FA 1SN1A 3JXUA 3KOZA 4CQKA 5FPMA 1ZFUA 1NGIA 3CW4A 3L56A 3PSMA 1OZZA 1KAZA 2KHOA 2A7TA 1ZU3A 2QW9A 3BK3C 1T0ZA 2YILA 2E8AA 4V1DC 1POIA 2E88A 4HWIA 2YIOA 5AQJA 2I61A 2LKBA 2KPYA 2QWOA 1LQHA 1CHZA 1QQOA 3L6QA 5AQRA 1DJTA 4UAEF 5AQWA 1T7EA 2N2QA 1BUPA 1LQIA 2G2KA 2N66A 3E7RL 4H5NA 3KP0A 5AQGA 5BN9A 1NGFA 3QFUA 2LR3A 5AQTA 2B68A 1NGDA 3KOYA 5EX5A 3KOWA 4AB0A 2MZ0A 1NE5A 1QQMA 5AQZA 1C56A 1NRAA 1NGHA 2BRZA 4H5WA 1SNBA 2B3CA 3E7UX 4FSVA 3FZFA 1T7BA 3GL1A 5AQIA 1HJOA 4HE7A 1ATRA 1ZUTA 2QWLA 5BPLA 1HX1A 1LQQA 2MBKA 2E3GA 5F2RA 2YIPA 1B3CA 2ATBA 1NRBA 5EY4A 3FZMA 4AEIA 4UADE 4H5RA 1ATSA 2LT8A
chains in the Genus database with same CATH topology
1ZYWA 4HHFA 1L4VA 1B7DA 1CN2A 1ZVEA 2YEOA 1PTXA 1KV0A 2M8BB 1AHOA 1JKZA 1T7AA 2KGQA 1DQ7A 1PE4A 2KBKA 1TI5A 1I6GA 1JXCA 2KJAA 1NH5A 5KK4A 1BK8A 2LI7A 1ZVGA 2E3FA 4KYPA 1T1TA 2N2RA 1MR4A 1MYNA 1OMYA 1P00A 2SN3A 1I2UA 1I2VA 1SEGA 1VNAA 1N4NA 5CY0A 1SN4A 1ICAA 1GPSA 1BMRA 1JZAA 1WMTA 2KBHA 4UJ0A 2LJMA 1NPIA 1AYJA 2LJ7A 1ZYVA 2GL1A 2YBRC 2ASCA 1PX9A 2NY9X 1C55A 2KYQA 2N69A 2E0HA 2KBJA 4AAZA 1WWNA 2LY5A 2NY8X 1VNBA 2KSKA 1FH3A 1WT7A 1GPTA 1JZBA 1P0AA 1BCGA 2LY6A 2YC1C 1I6FA 1SN1A 4CQKA 1ZFUA 3PSMA 1OZZA 2A7TA 1ZU3A 1T0ZA 4V1DC 2I61A 2LKBA 2KPYA 1LQHA 1CHZA 1DJTA 1T7EA 2N2QA 1LQIA 2N66A 3E7RL 2LR3A 2B68A 4AB0A 2MZ0A 1NE5A 1C56A 1NRAA 2BRZA 1SNBA 2B3CA 3E7UX 1T7BA 4HE7A 1ZUTA 1B3CA 1LQQA 2E3GA 2ATBA 1NRBA 4AEIA 1BRZA 2LT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZYW A;  4HHF A;  1L4V A;  1B7D A;  1CN2 A;  1ZVE A;  2YEO A;  1PTX A;  1KV0 A;  2M8B B;  1AHO A;  1JKZ A;  1T7A A;  2KGQ A;  1DQ7 A;  1PE4 A;  2KBK A;  1TI5 A;  1I6G A;  1JXC A;  2KJA A;  1NH5 A;  5KK4 A;  1BK8 A;  2LI7 A;  1ZVG A;  2E3F A;  4KYP A;  1T1T A;  2N2R A;  1MR4 A;  1MYN A;  1OMY A;  1P00 A;  2SN3 A;  1I2U A;  1I2V A;  1SEG A;  1VNA A;  1N4N A;  5CY0 A;  1SN4 A;  1ICA A;  1GPS A;  1BMR A;  1JZA A;  1WMT A;  2KBH A;  4UJ0 A;  2LJM A;  1NPI A;  1AYJ A;  2LJ7 A;  1ZYV A;  2GL1 A;  2YBR C;  2ASC A;  1PX9 A;  2NY9 X;  1C55 A;  2KYQ A;  2N69 A;  2E0H A;  2KBJ A;  4AAZ A;  1WWN A;  2LY5 A;  2NY8 X;  1VNB A;  2KSK A;  1FH3 A;  1WT7 A;  1GPT A;  1JZB A;  1P0A A;  1BCG A;  2LY6 A;  2YC1 C;  1I6F A;  1SN1 A;  4CQK A;  1ZFU A;  3PSM A;  1OZZ A;  2A7T A;  1ZU3 A;  1T0Z A;  4V1D C;  2I61 A;  2LKB A;  2KPY A;  1LQH A;  1CHZ A;  1DJT A;  1T7E A;  2N2Q A;  1LQI A;  2N66 A;  3E7R L;  2LR3 A;  2B68 A;  4AB0 A;  2MZ0 A;  1NE5 A;  1C56 A;  1NRA A;  2BRZ A;  1SNB A;  2B3C A;  3E7U X;  1T7B A;  4HE7 A;  1ZUT A;  1B3C A;  1LQQ A;  2E3G A;  2ATB A;  1NRB A;  4AEI A;  1BRZ A;  2LT8 A; 
#chains in the Genus database with same CATH topology
 1YUW A;  1ZYW A;  4HHF A;  5BPN A;  1B7D A;  5FPD A;  5BN8 A;  1CN2 A;  1L4V A;  1ZVE A;  2YEO A;  1PTX A;  1DKG D;  2QWQ A;  1KV0 A;  2M8B B;  2E2F A;  5EVZ A;  5F1X A;  2QWR A;  1AHO A;  1K8B A;  1JKZ A;  1T7A A;  2KGQ A;  3KHW A;  1NGJ A;  3FZL A;  3LDN A;  4H5V A;  1DQ7 A;  1PE4 A;  5AQV A;  3LDQ A;  3SF4 D;  2KBK A;  2LN8 A;  1TI5 A;  1QQN A;  5AQO A;  3GDQ A;  4KBO A;  3KOX A;  1I6G A;  5AQP A;  1JXC A;  3FZK A;  5AQS A;  1BA0 A;  2KJA A;  2QWM A;  3LDL A;  1NH5 A;  5KK4 A;  1BK8 A;  2LI7 A;  5FPE A;  1ZVG A;  2E3F A;  3KVG A;  3R2V A;  4KYP A;  1T1T A;  2N2R A;  3ATV A;  1MR4 A;  1MYN A;  2QWP A;  1OMY A;  1P00 A;  2SN3 A;  3ATU A;  3HSC A;  3L4I A;  1SEG A;  4IO8 A;  1VNA A;  5FPN A;  1I2V A;  4UAF E;  1N4N A;  3D2F A;  3FZH A;  5CY0 A;  3KP1 A;  1SN4 A;  1NGB A;  1UGL A;  2D56 A;  1XRS B;  2MN5 A;  2K35 A;  3FE1 A;  3AY9 A;  3GKU A;  4FL9 A;  4GNI A;  5AQU A;  1ICA A;  1S3X A;  3LDO A;  1GPS A;  2V7Z A;  4H5T A;  1JZA A;  1WMT A;  3KC6 A;  1BMR A;  2KBH A;  1KAX A;  5AQK A;  3QML A;  1BRZ A;  1HPM A;  5AQN A;  5AR0 A;  4UJ0 A;  2LJM A;  5AQX A;  5AQL A;  5AQY A;  1NPI A;  3CQX A;  1AYJ A;  2LJ7 A;  1ZYV A;  2GL1 A;  2YBR C;  2ASC A;  1PX9 A;  3C7N B;  1NGC A;  2NY9 X;  2GMO A;  2KYQ A;  2VY6 A;  1C55 A;  2N69 A;  3C7N A;  2E0H A;  5BPM A;  2KBJ A;  2BUP A;  1WWN A;  4AAZ A;  5F0X A;  2LY5 A;  3M3Z A;  2NY8 X;  1I2U A;  1VNB A;  5AQH A;  2KSK A;  3D2F B;  1BA1 A;  3LDP A;  1FH3 A;  3I33 A;  3A8Y A;  3D2E B;  5AQF A;  1WT7 A;  1NGA A;  1GPT A;  1KAY A;  3D2E A;  1NGG A;  3QI7 A;  3IUC A;  1JZB A;  5AQQ A;  1P0A A;  5EXW A;  2QXL A;  1BCG A;  2LY6 A;  1NGE A;  2YC1 C;  3QFP A;  5AQM A;  2JDQ D;  2QWN A;  1I6F A;  1SN1 A;  3JXU A;  3KOZ A;  4CQK A;  5FPM A;  1ZFU A;  1NGI A;  3CW4 A;  3L56 A;  3PSM A;  1OZZ A;  1KAZ A;  2KHO A;  2A7T A;  1ZU3 A;  2QW9 A;  3BK3 C;  1T0Z A;  2YIL A;  2E8A A;  4V1D C;  1POI A;  2E88 A;  4HWI A;  2YIO A;  5AQJ A;  2I61 A;  2LKB A;  2KPY A;  2QWO A;  1LQH A;  1CHZ A;  1QQO A;  3L6Q A;  5AQR A;  1DJT A;  4UAE F;  5AQW A;  1T7E A;  2N2Q A;  1BUP A;  1LQI A;  2G2K A;  2N66 A;  3E7R L;  4H5N A;  3KP0 A;  5AQG A;  5BN9 A;  1NGF A;  3QFU A;  2LR3 A;  5AQT A;  2B68 A;  1NGD A;  3KOY A;  5EX5 A;  3KOW A;  4AB0 A;  2MZ0 A;  1NE5 A;  1QQM A;  5AQZ A;  1C56 A;  1NRA A;  1NGH A;  2BRZ A;  4H5W A;  1SNB A;  2B3C A;  3E7U X;  4FSV A;  3FZF A;  1T7B A;  3GL1 A;  5AQI A;  1HJO A;  4HE7 A;  1ATR A;  1ZUT A;  2QWL A;  5BPL A;  1HX1 A;  1LQQ A;  2MBK A;  2E3G A;  5F2R A;  2YIP A;  1B3C A;  2ATB A;  1NRB A;  5EY4 A;  3FZM A;  4AEI A;  4UAD E;  4H5R A;  1ATS A;  2LT8 A; 
#chains in the Genus database with same CATH homology
 1ZYW A;  4HHF A;  1L4V A;  1B7D A;  1CN2 A;  1ZVE A;  2YEO A;  1PTX A;  1KV0 A;  2M8B B;  1AHO A;  1JKZ A;  1T7A A;  2KGQ A;  1DQ7 A;  1PE4 A;  2KBK A;  1TI5 A;  1I6G A;  1JXC A;  2KJA A;  1NH5 A;  5KK4 A;  1BK8 A;  2LI7 A;  1ZVG A;  2E3F A;  4KYP A;  1T1T A;  2N2R A;  1MR4 A;  1MYN A;  1OMY A;  1P00 A;  2SN3 A;  1I2U A;  1I2V A;  1SEG A;  1VNA A;  1N4N A;  5CY0 A;  1SN4 A;  1ICA A;  1GPS A;  1BMR A;  1JZA A;  1WMT A;  2KBH A;  4UJ0 A;  2LJM A;  1NPI A;  1AYJ A;  2LJ7 A;  1ZYV A;  2GL1 A;  2YBR C;  2ASC A;  1PX9 A;  2NY9 X;  1C55 A;  2KYQ A;  2N69 A;  2E0H A;  2KBJ A;  4AAZ A;  1WWN A;  2LY5 A;  2NY8 X;  1VNB A;  2KSK A;  1FH3 A;  1WT7 A;  1GPT A;  1JZB A;  1P0A A;  1BCG A;  2LY6 A;  2YC1 C;  1I6F A;  1SN1 A;  4CQK A;  1ZFU A;  3PSM A;  1OZZ A;  2A7T A;  1ZU3 A;  1T0Z A;  4V1D C;  2I61 A;  2LKB A;  2KPY A;  1LQH A;  1CHZ A;  1DJT A;  1T7E A;  2N2Q A;  1LQI A;  2N66 A;  3E7R L;  2LR3 A;  2B68 A;  4AB0 A;  2MZ0 A;  1NE5 A;  1C56 A;  1NRA A;  2BRZ A;  1SNB A;  2B3C A;  3E7U X;  1T7B A;  4HE7 A;  1ZUT A;  1B3C A;  1LQQ A;  2E3G A;  2ATB A;  1NRB A;  4AEI A;  1BRZ A;  2LT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...