1C56A

Nmr solution structure of butantoxin
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
40
structure length
40
Chain Sequence
b'WCSTCLDLACGASRECYDPCFKAFGRAHGKCMNNKCRCYT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BUTANTOXIN
publication title NMR solution structure of butantoxin.
pubmed doi rcsb
molecule tags Toxin
total genus 4
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 1999-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00451 Toxin_2 Scorpion short toxin, BmKK2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1c56A00
1VNAA 2N66A 2MZ0A 1ZYVA 3E7UX 4CQKA 1PX9A 2KYQA 1BRZA 1ZVEA 1SN4A 3E7RL 1DQ7A 1T7AA 2KGQA 1NH5A 4AB0A 2NY9X 2SN3A 2E3FA 1ZYWA 2LJMA 1NPIA 1FH3A 1P0AA 1C56A 1ZFUA 2N69A 1BK8A 1I6GA 1GPTA 1N4NA 1PE4A 2KBKA 4AAZA 2ASCA 2GL1A 1ZVGA 1NRBA 1TI5A 1SNBA 4AEIA 1JXCA 2LY6A 1DJTA 1PTXA 2E0HA 1T0ZA 1LQQA 1WT7A 2KSKA 3PSMA 1JZAA 1SEGA 2A7TA 1T7EA 1BMRA 1LQHA 2KPYA 1B3CA 1JZBA 1AYJA 1CN2A 1I2VA 2KJAA 1I2UA 1T7BA 1P00A 2I61A 2ATBA 4HE7A 1WWNA 2M8BB 2KBJA 1ICAA 2KBHA 1NE5A 1NRAA 2YC1C 2LR3A 4HHFA 1MYNA 2LI7A 1C55A 1I6FA 1WMTA 1KV0A 1SN1A 2BRZA 4UJ0A 1GPSA 4V1DC 5KK4A 2LJ7A 1B7DA 1AHOA 2LY5A 2B68A 1LQIA 1OMYA 2LT8A 2YBRC 1ZUTA 1T1TA 2NY8X 4KYPA 2LKBA 1BCGA 1OZZA 1VNBA 1ZU3A 2E3GA 1CHZA 1MR4A 2N2RA 1JKZA 5CY0A 2B3CA 2N2QA 1L4VA 2YEOA
chains in the Genus database with same CATH superfamily
1VNAA 2N66A 5AQYA 2MZ0A 1ZYVA 1KAYA 2QWOA 1PX9A 3E7UX 4CQKA 4FSVA 5BPNA 2MBKA 2KYQA 1BRZA 2G2KA 1ZVEA 1HX1A 1SN4A 3E7RL 3KHWA 3R2VA 1DQ7A 5AQFA 1T7AA 3KP1A 5AQHA 5AQVA 2D56A 3CW4A 2KGQA 5AQSA 1HJOA 1NH5A 5BPLA 4AB0A 3KOYA 3CQXA 2NY9X 2SN3A 4UADE 5AR0A 5FPMA 2E3FA 1ZYWA 2LJMA 1NPIA 5AQOA 2QW9A 5F0XA 4H5TA 3C7NB 1FH3A 1P0AA 1C56A 1ZFUA 2N69A 1BK8A 3FE1A 5BN9A 1I6GA 2E8AA 1GPTA 1QQOA 1NGCA 2BUPA 2QWNA 1N4NA 1PE4A 5AQZA 1NGDA 2KBKA 1ATSA 5EX5A 4AAZA 2ASCA 5AQTA 3C7NA 3IUCA 1NGHA 5FPNA 2GL1A 1ZVGA 1NRBA 5AQPA 1TI5A 1SNBA 3I33A 4AEIA 1JXCA 3ATVA 2LY6A 3FZFA 4H5VA 3LDNA 1DJTA 1PTXA 2E0HA 3LDOA 1QQMA 1T0ZA 1LQQA 1WT7A 2GMOA 2KSKA 3GKUA 3PSMA 2JDQD 1JZAA 3KC6A 3KP0A 3AY9A 1SEGA 1NGAA 2A7TA 2YIPA 3QFPA 1QQNA 1T7EA 5AQJA 2K35A 1BMRA 5AQXA 1LQHA 3KVGA 2KPYA 3QI7A 1JZBA 3GL1A 5FPDA 1B3CA 3HSCA 3SF4D 1AYJA 2KHOA 1CN2A 5AQUA 1I2VA 3BK3C 2QWPA 3D2EB 1NGGA 3KOXA 1ATRA 1UGLA 5F2RA 5BPMA 1YUWA 1HPMA 2KJAA 4H5NA 2QWQA 5AQNA 1NGFA 3ATUA 1KAZA 1BUPA 1T7BA 3GDQA 5AQWA 1I2UA 1NGBA 1P00A 2I61A 3FZMA 3LDQA 2QWLA 1BA1A 2ATBA 3KOZA 3A8YA 5AQGA 1XRSB 4HE7A 1WWNA 1NGJA 3D2FB 3JXUA 2M8BB 3L4IA 2KBJA 3LDLA 3LDPA 3FZKA 5AQIA 1ICAA 2KBHA 3QFUA 1NE5A 4UAEF 5EXWA 1BA0A 5AQLA 1NRAA 2YC1C 2LR3A 5AQQA 4HHFA 5EVZA 1MYNA 4KBOA 2LI7A 4H5RA 1POIA 1C55A 1I6FA 1WMTA 1KV0A 3D2FA 1SN1A 2BRZA 4UJ0A 2QXLA 2LN8A 1GPSA 2YIOA 5FPEA 5BN8A 1NGEA 4UAFE 4V1DC 1S3XA 1DKGD 2QWMA 5KK4A 2MN5A 5AQMA 2LJ7A 1B7DA 1NGIA 2YILA 3L6QA 4GNIA 1AHOA 5EY4A 2LY5A 3M3ZA 4H5WA 2B68A 1LQIA 1OMYA 5AQRA 3KOWA 5AQKA 2LT8A 2YBRC 3FZHA 1ZUTA 3D2EA 1T1TA 2NY8X 2V7ZA 4KYPA 2LKBA 1BCGA 2E88A 1OZZA 3QMLA 3L56A 4IO8A 1VNBA 4FL9A 1ZU3A 2E3GA 4HWIA 1CHZA 2E2FA 1KAXA 1MR4A 2N2RA 1JKZA 3FZLA 2VY6A 5CY0A 1K8BA 2B3CA 2N2QA 2QWRA 2YEOA 1L4VA 5F1XA
chains in the Genus database with same CATH topology
1VNAA 2N66A 2MZ0A 1ZYVA 3E7UX 4CQKA 1PX9A 2KYQA 1BRZA 1ZVEA 1SN4A 3E7RL 1DQ7A 1T7AA 2KGQA 1NH5A 4AB0A 2NY9X 2SN3A 2E3FA 1ZYWA 2LJMA 1NPIA 1FH3A 1P0AA 1C56A 1ZFUA 2N69A 1BK8A 1I6GA 1GPTA 1N4NA 1PE4A 2KBKA 4AAZA 2ASCA 2GL1A 1ZVGA 1NRBA 1TI5A 1SNBA 4AEIA 1JXCA 2LY6A 1DJTA 1PTXA 2E0HA 1T0ZA 1LQQA 1WT7A 2KSKA 3PSMA 1JZAA 1SEGA 2A7TA 1T7EA 1BMRA 1LQHA 2KPYA 1B3CA 1JZBA 1AYJA 1CN2A 1I2VA 2KJAA 1I2UA 1T7BA 1P00A 2I61A 2ATBA 4HE7A 1WWNA 2M8BB 2KBJA 1ICAA 2KBHA 1NE5A 1NRAA 2YC1C 2LR3A 4HHFA 1MYNA 2LI7A 1C55A 1I6FA 1WMTA 1KV0A 1SN1A 2BRZA 4UJ0A 1GPSA 4V1DC 5KK4A 2LJ7A 1B7DA 1AHOA 2LY5A 2B68A 1LQIA 1OMYA 2LT8A 2YBRC 1ZUTA 1T1TA 2NY8X 4KYPA 2LKBA 1BCGA 1OZZA 1VNBA 1ZU3A 2E3GA 1CHZA 1MR4A 2N2RA 1JKZA 5CY0A 2B3CA 2N2QA 1L4VA 2YEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VNA A;  2N66 A;  2MZ0 A;  1ZYV A;  3E7U X;  4CQK A;  1PX9 A;  2KYQ A;  1BRZ A;  1ZVE A;  1SN4 A;  3E7R L;  1DQ7 A;  1T7A A;  2KGQ A;  1NH5 A;  4AB0 A;  2NY9 X;  2SN3 A;  2E3F A;  1ZYW A;  2LJM A;  1NPI A;  1FH3 A;  1P0A A;  1C56 A;  1ZFU A;  2N69 A;  1BK8 A;  1I6G A;  1GPT A;  1N4N A;  1PE4 A;  2KBK A;  4AAZ A;  2ASC A;  2GL1 A;  1ZVG A;  1NRB A;  1TI5 A;  1SNB A;  4AEI A;  1JXC A;  2LY6 A;  1DJT A;  1PTX A;  2E0H A;  1T0Z A;  1LQQ A;  1WT7 A;  2KSK A;  3PSM A;  1JZA A;  1SEG A;  2A7T A;  1T7E A;  1BMR A;  1LQH A;  2KPY A;  1B3C A;  1JZB A;  1AYJ A;  1CN2 A;  1I2V A;  2KJA A;  1I2U A;  1T7B A;  1P00 A;  2I61 A;  2ATB A;  4HE7 A;  1WWN A;  2M8B B;  2KBJ A;  1ICA A;  2KBH A;  1NE5 A;  1NRA A;  2YC1 C;  2LR3 A;  4HHF A;  1MYN A;  2LI7 A;  1C55 A;  1I6F A;  1WMT A;  1KV0 A;  1SN1 A;  2BRZ A;  4UJ0 A;  1GPS A;  4V1D C;  5KK4 A;  2LJ7 A;  1B7D A;  1AHO A;  2LY5 A;  2B68 A;  1LQI A;  1OMY A;  2LT8 A;  2YBR C;  1ZUT A;  1T1T A;  2NY8 X;  4KYP A;  2LKB A;  1BCG A;  1OZZ A;  1VNB A;  1ZU3 A;  2E3G A;  1CHZ A;  1MR4 A;  2N2R A;  1JKZ A;  5CY0 A;  2B3C A;  2N2Q A;  1L4V A;  2YEO A; 
#chains in the Genus database with same CATH topology
 1VNA A;  2N66 A;  5AQY A;  2MZ0 A;  1ZYV A;  1KAY A;  2QWO A;  1PX9 A;  3E7U X;  4CQK A;  4FSV A;  5BPN A;  2MBK A;  2KYQ A;  1BRZ A;  2G2K A;  1ZVE A;  1HX1 A;  1SN4 A;  3E7R L;  3KHW A;  3R2V A;  1DQ7 A;  5AQF A;  1T7A A;  3KP1 A;  5AQH A;  5AQV A;  2D56 A;  3CW4 A;  2KGQ A;  5AQS A;  1HJO A;  1NH5 A;  5BPL A;  4AB0 A;  3KOY A;  3CQX A;  2NY9 X;  2SN3 A;  4UAD E;  5AR0 A;  5FPM A;  2E3F A;  1ZYW A;  2LJM A;  1NPI A;  5AQO A;  2QW9 A;  5F0X A;  4H5T A;  3C7N B;  1FH3 A;  1P0A A;  1C56 A;  1ZFU A;  2N69 A;  1BK8 A;  3FE1 A;  5BN9 A;  1I6G A;  2E8A A;  1GPT A;  1QQO A;  1NGC A;  2BUP A;  2QWN A;  1N4N A;  1PE4 A;  5AQZ A;  1NGD A;  2KBK A;  1ATS A;  5EX5 A;  4AAZ A;  2ASC A;  5AQT A;  3C7N A;  3IUC A;  1NGH A;  5FPN A;  2GL1 A;  1ZVG A;  1NRB A;  5AQP A;  1TI5 A;  1SNB A;  3I33 A;  4AEI A;  1JXC A;  3ATV A;  2LY6 A;  3FZF A;  4H5V A;  3LDN A;  1DJT A;  1PTX A;  2E0H A;  3LDO A;  1QQM A;  1T0Z A;  1LQQ A;  1WT7 A;  2GMO A;  2KSK A;  3GKU A;  3PSM A;  2JDQ D;  1JZA A;  3KC6 A;  3KP0 A;  3AY9 A;  1SEG A;  1NGA A;  2A7T A;  2YIP A;  3QFP A;  1QQN A;  1T7E A;  5AQJ A;  2K35 A;  1BMR A;  5AQX A;  1LQH A;  3KVG A;  2KPY A;  3QI7 A;  1JZB A;  3GL1 A;  5FPD A;  1B3C A;  3HSC A;  3SF4 D;  1AYJ A;  2KHO A;  1CN2 A;  5AQU A;  1I2V A;  3BK3 C;  2QWP A;  3D2E B;  1NGG A;  3KOX A;  1ATR A;  1UGL A;  5F2R A;  5BPM A;  1YUW A;  1HPM A;  2KJA A;  4H5N A;  2QWQ A;  5AQN A;  1NGF A;  3ATU A;  1KAZ A;  1BUP A;  1T7B A;  3GDQ A;  5AQW A;  1I2U A;  1NGB A;  1P00 A;  2I61 A;  3FZM A;  3LDQ A;  2QWL A;  1BA1 A;  2ATB A;  3KOZ A;  3A8Y A;  5AQG A;  1XRS B;  4HE7 A;  1WWN A;  1NGJ A;  3D2F B;  3JXU A;  2M8B B;  3L4I A;  2KBJ A;  3LDL A;  3LDP A;  3FZK A;  5AQI A;  1ICA A;  2KBH A;  3QFU A;  1NE5 A;  4UAE F;  5EXW A;  1BA0 A;  5AQL A;  1NRA A;  2YC1 C;  2LR3 A;  5AQQ A;  4HHF A;  5EVZ A;  1MYN A;  4KBO A;  2LI7 A;  4H5R A;  1POI A;  1C55 A;  1I6F A;  1WMT A;  1KV0 A;  3D2F A;  1SN1 A;  2BRZ A;  4UJ0 A;  2QXL A;  2LN8 A;  1GPS A;  2YIO A;  5FPE A;  5BN8 A;  1NGE A;  4UAF E;  4V1D C;  1S3X A;  1DKG D;  2QWM A;  5KK4 A;  2MN5 A;  5AQM A;  2LJ7 A;  1B7D A;  1NGI A;  2YIL A;  3L6Q A;  4GNI A;  1AHO A;  5EY4 A;  2LY5 A;  3M3Z A;  4H5W A;  2B68 A;  1LQI A;  1OMY A;  5AQR A;  3KOW A;  5AQK A;  2LT8 A;  2YBR C;  3FZH A;  1ZUT A;  3D2E A;  1T1T A;  2NY8 X;  2V7Z A;  4KYP A;  2LKB A;  1BCG A;  2E88 A;  1OZZ A;  3QML A;  3L56 A;  4IO8 A;  1VNB A;  4FL9 A;  1ZU3 A;  2E3G A;  4HWI A;  1CHZ A;  2E2F A;  1KAX A;  1MR4 A;  2N2R A;  1JKZ A;  3FZL A;  2VY6 A;  5CY0 A;  1K8B A;  2B3C A;  2N2Q A;  2QWR A;  2YEO A;  1L4V A;  5F1X A; 
#chains in the Genus database with same CATH homology
 1VNA A;  2N66 A;  2MZ0 A;  1ZYV A;  3E7U X;  4CQK A;  1PX9 A;  2KYQ A;  1BRZ A;  1ZVE A;  1SN4 A;  3E7R L;  1DQ7 A;  1T7A A;  2KGQ A;  1NH5 A;  4AB0 A;  2NY9 X;  2SN3 A;  2E3F A;  1ZYW A;  2LJM A;  1NPI A;  1FH3 A;  1P0A A;  1C56 A;  1ZFU A;  2N69 A;  1BK8 A;  1I6G A;  1GPT A;  1N4N A;  1PE4 A;  2KBK A;  4AAZ A;  2ASC A;  2GL1 A;  1ZVG A;  1NRB A;  1TI5 A;  1SNB A;  4AEI A;  1JXC A;  2LY6 A;  1DJT A;  1PTX A;  2E0H A;  1T0Z A;  1LQQ A;  1WT7 A;  2KSK A;  3PSM A;  1JZA A;  1SEG A;  2A7T A;  1T7E A;  1BMR A;  1LQH A;  2KPY A;  1B3C A;  1JZB A;  1AYJ A;  1CN2 A;  1I2V A;  2KJA A;  1I2U A;  1T7B A;  1P00 A;  2I61 A;  2ATB A;  4HE7 A;  1WWN A;  2M8B B;  2KBJ A;  1ICA A;  2KBH A;  1NE5 A;  1NRA A;  2YC1 C;  2LR3 A;  4HHF A;  1MYN A;  2LI7 A;  1C55 A;  1I6F A;  1WMT A;  1KV0 A;  1SN1 A;  2BRZ A;  4UJ0 A;  1GPS A;  4V1D C;  5KK4 A;  2LJ7 A;  1B7D A;  1AHO A;  2LY5 A;  2B68 A;  1LQI A;  1OMY A;  2LT8 A;  2YBR C;  1ZUT A;  1T1T A;  2NY8 X;  4KYP A;  2LKB A;  1BCG A;  1OZZ A;  1VNB A;  1ZU3 A;  2E3G A;  1CHZ A;  1MR4 A;  2N2R A;  1JKZ A;  5CY0 A;  2B3C A;  2N2Q A;  1L4V A;  2YEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...