1C56A

Nmr solution structure of butantoxin
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
40
structure length
40
Chain Sequence
WCSTCLDLACGASRECYDPCFKAFGRAHGKCMNNKCRCYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BUTANTOXIN
publication title NMR solution structure of butantoxin.
pubmed doi rcsb
molecule tags Toxin
total genus 4
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 1999-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00451 Toxin_2 Scorpion short toxin, BmKK2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1c56A00
1NRAA 1ZFUA 1BRZA 2GL1A 2LJ7A 2ATBA 1T7AA 4HHFA 1BK8A 1NH5A 3E7RL 1OMYA 4AAZA 1GPTA 2KGQA 1ZVGA 1T0ZA 2LJMA 1C56A 2KBKA 1KV0A 1ZYWA 2YC1C 1LQHA 1BCGA 4CQKA 1N4NA 2KPYA 2ASCA 1WMTA 1GPSA 1DJTA 2M8BB 4HE7A 1LQIA 1JKZA 2LKBA 2KBJA 1WWNA 1L4VA 2LI7A 1SN1A 2NY9X 2BRZA 1NPIA 1ZU3A 1PTXA 1I2UA 1TI5A 4KYPA 2LY6A 1CN2A 2N2QA 2N69A 1JZBA 2NY8X 1MYNA 2E3GA 1NE5A 1VNBA 1I6GA 1ICAA 3PSMA 1B7DA 1SN4A 1DQ7A 1JZAA 2KBHA 5CY0A 1VNAA 1NRBA 1FH3A 2B68A 2YEOA 1C55A 2N2RA 1I6FA 2KYQA 3E7UX 1OZZA 1PX9A 1P00A 2SN3A 5KK4A 1T1TA 4AB0A 2I61A 2MZ0A 1JXCA 1I2VA 2N66A 4AEIA 1ZUTA 2LY5A 2KSKA 1AYJA 1T7EA 1PE4A 1MR4A 1CHZA 2YBRC 2KJAA 1ZYVA 1SEGA 1BMRA 2B3CA 1LQQA 1P0AA 2A7TA 2LT8A 1WT7A 2LR3A 1T7BA 2E0HA 1AHOA 4UJ0A 1B3CA 1SNBA 2E3FA 4V1DC 1ZVEA
chains in the Genus database with same CATH superfamily
3LDLA 1NRAA 1ZFUA 5AQLA 1BRZA 1BUPA 3GKUA 2VY6A 2GL1A 2LJ7A 3KP1A 1NGGA 1T7AA 2ATBA 2QWPA 4HHFA 5AQIA 1BK8A 3ATUA 3IUCA 1NH5A 1BA0A 1OMYA 3E7RL 3I33A 2E88A 4AAZA 2YIPA 5EXWA 4GNIA 1GPTA 2QWOA 2KGQA 1ZVGA 1T0ZA 2LJMA 1C56A 3CQXA 2KBKA 1K8BA 3D2FA 1KV0A 1ZYWA 5AR0A 2YC1C 3KOZA 2D56A 5EY4A 1LQHA 5AQUA 3D2EA 1BCGA 4CQKA 3D2FB 1N4NA 2KPYA 5FPDA 3QI7A 3FZLA 3D2EB 2ASCA 3KC6A 3M3ZA 4H5NA 5AQRA 3SF4D 2V7ZA 1WMTA 3R2VA 1GPSA 1DJTA 3GDQA 2M8BB 2E8AA 1LQIA 2QWMA 4HE7A 1JKZA 3JXUA 1HJOA 2LKBA 1UGLA 3KHWA 5AQWA 1KAXA 1NGAA 2KBJA 2BUPA 1WWNA 1L4VA 2QWQA 5AQHA 2LI7A 1POIA 2QWRA 1SN1A 2NY9X 1NGIA 2BRZA 5AQSA 5BPMA 4H5WA 5F2RA 3AY9A 3FZKA 1NPIA 1ATRA 1ZU3A 1PTXA 5AQMA 5FPNA 1I2UA 1TI5A 2QW9A 4KYPA 2QWNA 2LY6A 1DKGD 2MBKA 3LDQA 1CN2A 1NGEA 2N2QA 1NGHA 2YILA 1HPMA 2E2FA 1HX1A 2N69A 3A8YA 1JZBA 2NY8X 1S3XA 2K35A 4HWIA 4UADE 3QFPA 1MYNA 3LDPA 1YUWA 5AQTA 2E3GA 1NE5A 1QQMA 1VNBA 4FL9A 1QQNA 5AQVA 1I6GA 1NGJA 1NGDA 1ICAA 2G2KA 3PSMA 1B7DA 1SN4A 4UAFE 5AQGA 1DQ7A 1ATSA 1JZAA 2KBHA 5BN8A 5CY0A 1VNAA 1NRBA 1FH3A 4UAEF 2B68A 2MN5A 2YEOA 2LN8A 1C55A 2N2RA 5AQYA 1I6FA 1KAYA 5AQZA 3CW4A 1NGCA 2KYQA 5BPNA 3E7UX 5F0XA 1OZZA 1PX9A 4KBOA 3ATVA 2QWLA 5AQQA 1P00A 1QQOA 3L56A 2YIOA 4FSVA 3FE1A 2SN3A 5KK4A 1T1TA 4AB0A 3LDNA 1BA1A 1NGFA 2I61A 5F1XA 2MZ0A 1JXCA 5AQFA 1XRSB 4H5RA 5BPLA 1I2VA 2N66A 4AEIA 1ZUTA 2LY5A 2QXLA 3KOWA 1KAZA 3FZHA 3LDOA 3L4IA 2KSKA 1AYJA 1T7EA 1NGBA 1PE4A 5BN9A 1MR4A 1CHZA 4H5TA 3QFUA 5AQKA 3BK3C 2YBRC 3FZMA 3KP0A 2KJAA 1ZYVA 5AQOA 1SEGA 5AQXA 5FPMA 5EX5A 1BMRA 5AQPA 3L6QA 2B3CA 3KVGA 1LQQA 1P0AA 2A7TA 2LT8A 1WT7A 3FZFA 3HSCA 3C7NA 2LR3A 4H5VA 1T7BA 2E0HA 4IO8A 1AHOA 2JDQD 3KOYA 5AQNA 2GMOA 3C7NB 5AQJA 3GL1A 4UJ0A 2KHOA 3KOXA 3QMLA 1B3CA 1SNBA 2E3FA 4V1DC 5FPEA 5EVZA 1ZVEA
chains in the Genus database with same CATH topology
1NRAA 1ZFUA 1BRZA 2GL1A 2LJ7A 2ATBA 1T7AA 4HHFA 1BK8A 1NH5A 3E7RL 1OMYA 4AAZA 1GPTA 2KGQA 1ZVGA 1T0ZA 2LJMA 1C56A 2KBKA 1KV0A 1ZYWA 2YC1C 1LQHA 1BCGA 4CQKA 1N4NA 2KPYA 2ASCA 1WMTA 1GPSA 1DJTA 2M8BB 4HE7A 1LQIA 1JKZA 2LKBA 2KBJA 1WWNA 1L4VA 2LI7A 1SN1A 2NY9X 2BRZA 1NPIA 1ZU3A 1PTXA 1I2UA 1TI5A 4KYPA 2LY6A 1CN2A 2N2QA 2N69A 1JZBA 2NY8X 1MYNA 2E3GA 1NE5A 1VNBA 1I6GA 1ICAA 3PSMA 1B7DA 1SN4A 1DQ7A 1JZAA 2KBHA 5CY0A 1VNAA 1NRBA 1FH3A 2B68A 2YEOA 1C55A 2N2RA 1I6FA 2KYQA 3E7UX 1OZZA 1PX9A 1P00A 2SN3A 5KK4A 1T1TA 4AB0A 2I61A 2MZ0A 1JXCA 1I2VA 2N66A 4AEIA 1ZUTA 2LY5A 2KSKA 1AYJA 1T7EA 1PE4A 1MR4A 1CHZA 2YBRC 2KJAA 1ZYVA 1SEGA 1BMRA 2B3CA 1LQQA 1P0AA 2A7TA 2LT8A 1WT7A 2LR3A 1T7BA 2E0HA 1AHOA 4UJ0A 1B3CA 1SNBA 2E3FA 4V1DC 1ZVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NRA A;  1ZFU A;  1BRZ A;  2GL1 A;  2LJ7 A;  2ATB A;  1T7A A;  4HHF A;  1BK8 A;  1NH5 A;  3E7R L;  1OMY A;  4AAZ A;  1GPT A;  2KGQ A;  1ZVG A;  1T0Z A;  2LJM A;  1C56 A;  2KBK A;  1KV0 A;  1ZYW A;  2YC1 C;  1LQH A;  1BCG A;  4CQK A;  1N4N A;  2KPY A;  2ASC A;  1WMT A;  1GPS A;  1DJT A;  2M8B B;  4HE7 A;  1LQI A;  1JKZ A;  2LKB A;  2KBJ A;  1WWN A;  1L4V A;  2LI7 A;  1SN1 A;  2NY9 X;  2BRZ A;  1NPI A;  1ZU3 A;  1PTX A;  1I2U A;  1TI5 A;  4KYP A;  2LY6 A;  1CN2 A;  2N2Q A;  2N69 A;  1JZB A;  2NY8 X;  1MYN A;  2E3G A;  1NE5 A;  1VNB A;  1I6G A;  1ICA A;  3PSM A;  1B7D A;  1SN4 A;  1DQ7 A;  1JZA A;  2KBH A;  5CY0 A;  1VNA A;  1NRB A;  1FH3 A;  2B68 A;  2YEO A;  1C55 A;  2N2R A;  1I6F A;  2KYQ A;  3E7U X;  1OZZ A;  1PX9 A;  1P00 A;  2SN3 A;  5KK4 A;  1T1T A;  4AB0 A;  2I61 A;  2MZ0 A;  1JXC A;  1I2V A;  2N66 A;  4AEI A;  1ZUT A;  2LY5 A;  2KSK A;  1AYJ A;  1T7E A;  1PE4 A;  1MR4 A;  1CHZ A;  2YBR C;  2KJA A;  1ZYV A;  1SEG A;  1BMR A;  2B3C A;  1LQQ A;  1P0A A;  2A7T A;  2LT8 A;  1WT7 A;  2LR3 A;  1T7B A;  2E0H A;  1AHO A;  4UJ0 A;  1B3C A;  1SNB A;  2E3F A;  4V1D C;  1ZVE A; 
#chains in the Genus database with same CATH topology
 3LDL A;  1NRA A;  1ZFU A;  5AQL A;  1BRZ A;  1BUP A;  3GKU A;  2VY6 A;  2GL1 A;  2LJ7 A;  3KP1 A;  1NGG A;  1T7A A;  2ATB A;  2QWP A;  4HHF A;  5AQI A;  1BK8 A;  3ATU A;  3IUC A;  1NH5 A;  1BA0 A;  1OMY A;  3E7R L;  3I33 A;  2E88 A;  4AAZ A;  2YIP A;  5EXW A;  4GNI A;  1GPT A;  2QWO A;  2KGQ A;  1ZVG A;  1T0Z A;  2LJM A;  1C56 A;  3CQX A;  2KBK A;  1K8B A;  3D2F A;  1KV0 A;  1ZYW A;  5AR0 A;  2YC1 C;  3KOZ A;  2D56 A;  5EY4 A;  1LQH A;  5AQU A;  3D2E A;  1BCG A;  4CQK A;  3D2F B;  1N4N A;  2KPY A;  5FPD A;  3QI7 A;  3FZL A;  3D2E B;  2ASC A;  3KC6 A;  3M3Z A;  4H5N A;  5AQR A;  3SF4 D;  2V7Z A;  1WMT A;  3R2V A;  1GPS A;  1DJT A;  3GDQ A;  2M8B B;  2E8A A;  1LQI A;  2QWM A;  4HE7 A;  1JKZ A;  3JXU A;  1HJO A;  2LKB A;  1UGL A;  3KHW A;  5AQW A;  1KAX A;  1NGA A;  2KBJ A;  2BUP A;  1WWN A;  1L4V A;  2QWQ A;  5AQH A;  2LI7 A;  1POI A;  2QWR A;  1SN1 A;  2NY9 X;  1NGI A;  2BRZ A;  5AQS A;  5BPM A;  4H5W A;  5F2R A;  3AY9 A;  3FZK A;  1NPI A;  1ATR A;  1ZU3 A;  1PTX A;  5AQM A;  5FPN A;  1I2U A;  1TI5 A;  2QW9 A;  4KYP A;  2QWN A;  2LY6 A;  1DKG D;  2MBK A;  3LDQ A;  1CN2 A;  1NGE A;  2N2Q A;  1NGH A;  2YIL A;  1HPM A;  2E2F A;  1HX1 A;  2N69 A;  3A8Y A;  1JZB A;  2NY8 X;  1S3X A;  2K35 A;  4HWI A;  4UAD E;  3QFP A;  1MYN A;  3LDP A;  1YUW A;  5AQT A;  2E3G A;  1NE5 A;  1QQM A;  1VNB A;  4FL9 A;  1QQN A;  5AQV A;  1I6G A;  1NGJ A;  1NGD A;  1ICA A;  2G2K A;  3PSM A;  1B7D A;  1SN4 A;  4UAF E;  5AQG A;  1DQ7 A;  1ATS A;  1JZA A;  2KBH A;  5BN8 A;  5CY0 A;  1VNA A;  1NRB A;  1FH3 A;  4UAE F;  2B68 A;  2MN5 A;  2YEO A;  2LN8 A;  1C55 A;  2N2R A;  5AQY A;  1I6F A;  1KAY A;  5AQZ A;  3CW4 A;  1NGC A;  2KYQ A;  5BPN A;  3E7U X;  5F0X A;  1OZZ A;  1PX9 A;  4KBO A;  3ATV A;  2QWL A;  5AQQ A;  1P00 A;  1QQO A;  3L56 A;  2YIO A;  4FSV A;  3FE1 A;  2SN3 A;  5KK4 A;  1T1T A;  4AB0 A;  3LDN A;  1BA1 A;  1NGF A;  2I61 A;  5F1X A;  2MZ0 A;  1JXC A;  5AQF A;  1XRS B;  4H5R A;  5BPL A;  1I2V A;  2N66 A;  4AEI A;  1ZUT A;  2LY5 A;  2QXL A;  3KOW A;  1KAZ A;  3FZH A;  3LDO A;  3L4I A;  2KSK A;  1AYJ A;  1T7E A;  1NGB A;  1PE4 A;  5BN9 A;  1MR4 A;  1CHZ A;  4H5T A;  3QFU A;  5AQK A;  3BK3 C;  2YBR C;  3FZM A;  3KP0 A;  2KJA A;  1ZYV A;  5AQO A;  1SEG A;  5AQX A;  5FPM A;  5EX5 A;  1BMR A;  5AQP A;  3L6Q A;  2B3C A;  3KVG A;  1LQQ A;  1P0A A;  2A7T A;  2LT8 A;  1WT7 A;  3FZF A;  3HSC A;  3C7N A;  2LR3 A;  4H5V A;  1T7B A;  2E0H A;  4IO8 A;  1AHO A;  2JDQ D;  3KOY A;  5AQN A;  2GMO A;  3C7N B;  5AQJ A;  3GL1 A;  4UJ0 A;  2KHO A;  3KOX A;  3QML A;  1B3C A;  1SNB A;  2E3F A;  4V1D C;  5FPE A;  5EVZ A;  1ZVE A; 
#chains in the Genus database with same CATH homology
 1NRA A;  1ZFU A;  1BRZ A;  2GL1 A;  2LJ7 A;  2ATB A;  1T7A A;  4HHF A;  1BK8 A;  1NH5 A;  3E7R L;  1OMY A;  4AAZ A;  1GPT A;  2KGQ A;  1ZVG A;  1T0Z A;  2LJM A;  1C56 A;  2KBK A;  1KV0 A;  1ZYW A;  2YC1 C;  1LQH A;  1BCG A;  4CQK A;  1N4N A;  2KPY A;  2ASC A;  1WMT A;  1GPS A;  1DJT A;  2M8B B;  4HE7 A;  1LQI A;  1JKZ A;  2LKB A;  2KBJ A;  1WWN A;  1L4V A;  2LI7 A;  1SN1 A;  2NY9 X;  2BRZ A;  1NPI A;  1ZU3 A;  1PTX A;  1I2U A;  1TI5 A;  4KYP A;  2LY6 A;  1CN2 A;  2N2Q A;  2N69 A;  1JZB A;  2NY8 X;  1MYN A;  2E3G A;  1NE5 A;  1VNB A;  1I6G A;  1ICA A;  3PSM A;  1B7D A;  1SN4 A;  1DQ7 A;  1JZA A;  2KBH A;  5CY0 A;  1VNA A;  1NRB A;  1FH3 A;  2B68 A;  2YEO A;  1C55 A;  2N2R A;  1I6F A;  2KYQ A;  3E7U X;  1OZZ A;  1PX9 A;  1P00 A;  2SN3 A;  5KK4 A;  1T1T A;  4AB0 A;  2I61 A;  2MZ0 A;  1JXC A;  1I2V A;  2N66 A;  4AEI A;  1ZUT A;  2LY5 A;  2KSK A;  1AYJ A;  1T7E A;  1PE4 A;  1MR4 A;  1CHZ A;  2YBR C;  2KJA A;  1ZYV A;  1SEG A;  1BMR A;  2B3C A;  1LQQ A;  1P0A A;  2A7T A;  2LT8 A;  1WT7 A;  2LR3 A;  1T7B A;  2E0H A;  1AHO A;  4UJ0 A;  1B3C A;  1SNB A;  2E3F A;  4V1D C;  1ZVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...