1P0AA

Nmr structure of etd135, mutant of the antifungal defensin ard1 from archaeoprepona demophon
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
44
structure length
44
Chain Sequence
b'DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFLNVNCWCET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEFENSIN ARD1
publication title Lead optimization of antifungal peptides with 3D NMR structures analysis.
pubmed doi rcsb
source organism Archaeoprepona demophon
molecule tags Antifungal protein
total genus 8
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2003-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1p0aA00
2YEOA 3E7UX 2YBRC 1C56A 1P00A 1SN4A 2M8BB 1L4VA 2KYQA 2E3GA 1T1TA 1PTXA 1T7BA 2SN3A 2LR3A 4V1DC 2NY8X 2B68A 2N2QA 1NH5A 1KV0A 4CQKA 2N66A 1DQ7A 2KJAA 1SN1A 2ASCA 1CN2A 2YC1C 5KK4A 1NE5A 1B3CA 4AB0A 1GPSA 1MR4A 1VNAA 1WT7A 1ZUTA 1ZVGA 1AYJA 2N2RA 4AEIA 1B7DA 1JZAA 2KBHA 2LY5A 1ZVEA 1ZYWA 2I61A 2E3FA 1I6FA 1OZZA 4HHFA 2BRZA 1AHOA 2LT8A 1BCGA 3PSMA 4AAZA 1JKZA 2LY6A 1SNBA 2MZ0A 1MYNA 1I2VA 2KBKA 2LJ7A 1ICAA 1ZYVA 2B3CA 1ZU3A 2NY9X 1FH3A 4UJ0A 1NRBA 1VNBA 1PX9A 2ATBA 1T7AA 1NPIA 2LJMA 1BK8A 2N69A 4HE7A 1NRAA 1BMRA 1ZFUA 1C55A 5CY0A 1I2UA 1JZBA 2A7TA 1JXCA 1P0AA 1GPTA 2GL1A 1LQQA 1T7EA 1WWNA 1LQHA 4KYPA 1LQIA 1T0ZA 1N4NA 1SEGA 1OMYA 2E0HA 2KBJA 1I6GA 2LKBA 3E7RL 2LI7A 1TI5A 1CHZA 1DJTA 1PE4A 2KPYA 1WMTA 2KGQA 2KSKA 1BRZA
chains in the Genus database with same CATH superfamily
4FL9A 1KAZA 2YEOA 3E7UX 3KOWA 1NGCA 2YBRC 3FZHA 5AQJA 5AQWA 1NGGA 2MBKA 1ATRA 1C56A 4H5VA 1P00A 1SN4A 2M8BB 1L4VA 2QWNA 2KYQA 2E3GA 1T1TA 1PTXA 1T7BA 2QWMA 2SN3A 2LR3A 1NGHA 3D2FA 3QFUA 5AQKA 5FPMA 3KC6A 3KVGA 4V1DC 2NY8X 2B68A 3D2EB 2N2QA 3IUCA 1DKGD 1NH5A 2QWPA 5F1XA 1NGIA 5BN9A 5FPEA 1KV0A 1QQNA 2D56A 4CQKA 2N66A 1DQ7A 2KJAA 1SN1A 2ASCA 1CN2A 5AQUA 4H5TA 2G2KA 5F2RA 3LDPA 2YC1C 5KK4A 1NE5A 1B3CA 3QI7A 4AB0A 1GPSA 1UGLA 1MR4A 5AQTA 1ATSA 1VNAA 1WT7A 1ZUTA 3SF4D 1ZVGA 1AYJA 2N2RA 3QFPA 4AEIA 1B7DA 3QMLA 1JZAA 4H5RA 2KBHA 1HPMA 1KAXA 1ZVEA 2LY5A 1ZYWA 5AQFA 5BPLA 2I61A 2E3FA 2QWLA 3L6QA 1I6FA 3KP0A 5BPNA 1OZZA 2QWOA 4HHFA 4IO8A 5AQIA 2BRZA 1AHOA 1BUPA 2LT8A 2BUPA 1BCGA 3PSMA 3D2EA 2E8AA 3LDOA 4AAZA 1JKZA 2LY6A 1SNBA 3BK3C 5EY4A 2MZ0A 2QXLA 4H5WA 1MYNA 1I2VA 2KBKA 5AQYA 5BPMA 5FPNA 3CQXA 2LJ7A 1ICAA 1ZYVA 1HJOA 3FZMA 2B3CA 3KOYA 3C7NB 3FE1A 3GDQA 1ZU3A 2NY9X 5AQNA 1FH3A 3LDNA 1HX1A 5AQVA 2K35A 3HSCA 4H5NA 5AQPA 4UJ0A 1NRBA 5AQZA 3I33A 1BA1A 1QQOA 2JDQD 1VNBA 2QWRA 5FPDA 1POIA 1NGJA 3A8YA 1PX9A 3FZFA 4UADE 5AQGA 2ATBA 2VY6A 1T7AA 4HWIA 2E2FA 2E88A 1NPIA 2LJMA 1BK8A 1NGBA 2N69A 4HE7A 5AQRA 1NRAA 3FZLA 3M3ZA 5AQLA 3ATVA 5AQOA 5EXWA 1ZFUA 5EVZA 2V7ZA 3AY9A 3JXUA 5CY0A 1BMRA 5BN8A 1C55A 1I2UA 3GKUA 5EX5A 1JZBA 3R2VA 5AQSA 1NGEA 1NGAA 2A7TA 3KP1A 5AQXA 5AQHA 3L4IA 1JXCA 1P0AA 1GPTA 5AR0A 2GL1A 2LN8A 3D2FB 1NGFA 1KAYA 1LQQA 1QQMA 1T7EA 2MN5A 3L56A 3LDQA 4FSVA 1WWNA 4UAEF 5F0XA 3FZKA 3LDLA 3C7NA 2YIPA 3GL1A 2QWQA 1LQHA 2QW9A 2GMOA 4KYPA 1LQIA 2YILA 1NGDA 4UAFE 1T0ZA 1N4NA 2KHOA 1SEGA 3KOXA 5AQQA 5AQMA 4KBOA 1OMYA 2E0HA 2KBJA 1I6GA 2LKBA 3KOZA 3ATUA 3E7RL 1BA0A 3KHWA 2YIOA 1YUWA 1S3XA 3CW4A 2LI7A 1TI5A 1CHZA 1DJTA 1PE4A 2KPYA 1WMTA 1K8BA 4GNIA 2KGQA 2KSKA 1XRSB 1BRZA
chains in the Genus database with same CATH topology
2YEOA 3E7UX 2YBRC 1C56A 1P00A 1SN4A 2M8BB 1L4VA 2KYQA 2E3GA 1T1TA 1PTXA 1T7BA 2SN3A 2LR3A 4V1DC 2NY8X 2B68A 2N2QA 1NH5A 1KV0A 4CQKA 2N66A 1DQ7A 2KJAA 1SN1A 2ASCA 1CN2A 2YC1C 5KK4A 1NE5A 1B3CA 4AB0A 1GPSA 1MR4A 1VNAA 1WT7A 1ZUTA 1ZVGA 1AYJA 2N2RA 4AEIA 1B7DA 1JZAA 2KBHA 2LY5A 1ZVEA 1ZYWA 2I61A 2E3FA 1I6FA 1OZZA 4HHFA 2BRZA 1AHOA 2LT8A 1BCGA 3PSMA 4AAZA 1JKZA 2LY6A 1SNBA 2MZ0A 1MYNA 1I2VA 2KBKA 2LJ7A 1ICAA 1ZYVA 2B3CA 1ZU3A 2NY9X 1FH3A 4UJ0A 1NRBA 1VNBA 1PX9A 2ATBA 1T7AA 1NPIA 2LJMA 1BK8A 2N69A 4HE7A 1NRAA 1BMRA 1ZFUA 1C55A 5CY0A 1I2UA 1JZBA 2A7TA 1JXCA 1P0AA 1GPTA 2GL1A 1LQQA 1T7EA 1WWNA 1LQHA 4KYPA 1LQIA 1T0ZA 1N4NA 1SEGA 1OMYA 2E0HA 2KBJA 1I6GA 2LKBA 3E7RL 2LI7A 1TI5A 1CHZA 1DJTA 1PE4A 2KPYA 1WMTA 2KGQA 2KSKA 1BRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEO A;  3E7U X;  2YBR C;  1C56 A;  1P00 A;  1SN4 A;  2M8B B;  1L4V A;  2KYQ A;  2E3G A;  1T1T A;  1PTX A;  1T7B A;  2SN3 A;  2LR3 A;  4V1D C;  2NY8 X;  2B68 A;  2N2Q A;  1NH5 A;  1KV0 A;  4CQK A;  2N66 A;  1DQ7 A;  2KJA A;  1SN1 A;  2ASC A;  1CN2 A;  2YC1 C;  5KK4 A;  1NE5 A;  1B3C A;  4AB0 A;  1GPS A;  1MR4 A;  1VNA A;  1WT7 A;  1ZUT A;  1ZVG A;  1AYJ A;  2N2R A;  4AEI A;  1B7D A;  1JZA A;  2KBH A;  2LY5 A;  1ZVE A;  1ZYW A;  2I61 A;  2E3F A;  1I6F A;  1OZZ A;  4HHF A;  2BRZ A;  1AHO A;  2LT8 A;  1BCG A;  3PSM A;  4AAZ A;  1JKZ A;  2LY6 A;  1SNB A;  2MZ0 A;  1MYN A;  1I2V A;  2KBK A;  2LJ7 A;  1ICA A;  1ZYV A;  2B3C A;  1ZU3 A;  2NY9 X;  1FH3 A;  4UJ0 A;  1NRB A;  1VNB A;  1PX9 A;  2ATB A;  1T7A A;  1NPI A;  2LJM A;  1BK8 A;  2N69 A;  4HE7 A;  1NRA A;  1BMR A;  1ZFU A;  1C55 A;  5CY0 A;  1I2U A;  1JZB A;  2A7T A;  1JXC A;  1P0A A;  1GPT A;  2GL1 A;  1LQQ A;  1T7E A;  1WWN A;  1LQH A;  4KYP A;  1LQI A;  1T0Z A;  1N4N A;  1SEG A;  1OMY A;  2E0H A;  2KBJ A;  1I6G A;  2LKB A;  3E7R L;  2LI7 A;  1TI5 A;  1CHZ A;  1DJT A;  1PE4 A;  2KPY A;  1WMT A;  2KGQ A;  2KSK A;  1BRZ A; 
#chains in the Genus database with same CATH topology
 4FL9 A;  1KAZ A;  2YEO A;  3E7U X;  3KOW A;  1NGC A;  2YBR C;  3FZH A;  5AQJ A;  5AQW A;  1NGG A;  2MBK A;  1ATR A;  1C56 A;  4H5V A;  1P00 A;  1SN4 A;  2M8B B;  1L4V A;  2QWN A;  2KYQ A;  2E3G A;  1T1T A;  1PTX A;  1T7B A;  2QWM A;  2SN3 A;  2LR3 A;  1NGH A;  3D2F A;  3QFU A;  5AQK A;  5FPM A;  3KC6 A;  3KVG A;  4V1D C;  2NY8 X;  2B68 A;  3D2E B;  2N2Q A;  3IUC A;  1DKG D;  1NH5 A;  2QWP A;  5F1X A;  1NGI A;  5BN9 A;  5FPE A;  1KV0 A;  1QQN A;  2D56 A;  4CQK A;  2N66 A;  1DQ7 A;  2KJA A;  1SN1 A;  2ASC A;  1CN2 A;  5AQU A;  4H5T A;  2G2K A;  5F2R A;  3LDP A;  2YC1 C;  5KK4 A;  1NE5 A;  1B3C A;  3QI7 A;  4AB0 A;  1GPS A;  1UGL A;  1MR4 A;  5AQT A;  1ATS A;  1VNA A;  1WT7 A;  1ZUT A;  3SF4 D;  1ZVG A;  1AYJ A;  2N2R A;  3QFP A;  4AEI A;  1B7D A;  3QML A;  1JZA A;  4H5R A;  2KBH A;  1HPM A;  1KAX A;  1ZVE A;  2LY5 A;  1ZYW A;  5AQF A;  5BPL A;  2I61 A;  2E3F A;  2QWL A;  3L6Q A;  1I6F A;  3KP0 A;  5BPN A;  1OZZ A;  2QWO A;  4HHF A;  4IO8 A;  5AQI A;  2BRZ A;  1AHO A;  1BUP A;  2LT8 A;  2BUP A;  1BCG A;  3PSM A;  3D2E A;  2E8A A;  3LDO A;  4AAZ A;  1JKZ A;  2LY6 A;  1SNB A;  3BK3 C;  5EY4 A;  2MZ0 A;  2QXL A;  4H5W A;  1MYN A;  1I2V A;  2KBK A;  5AQY A;  5BPM A;  5FPN A;  3CQX A;  2LJ7 A;  1ICA A;  1ZYV A;  1HJO A;  3FZM A;  2B3C A;  3KOY A;  3C7N B;  3FE1 A;  3GDQ A;  1ZU3 A;  2NY9 X;  5AQN A;  1FH3 A;  3LDN A;  1HX1 A;  5AQV A;  2K35 A;  3HSC A;  4H5N A;  5AQP A;  4UJ0 A;  1NRB A;  5AQZ A;  3I33 A;  1BA1 A;  1QQO A;  2JDQ D;  1VNB A;  2QWR A;  5FPD A;  1POI A;  1NGJ A;  3A8Y A;  1PX9 A;  3FZF A;  4UAD E;  5AQG A;  2ATB A;  2VY6 A;  1T7A A;  4HWI A;  2E2F A;  2E88 A;  1NPI A;  2LJM A;  1BK8 A;  1NGB A;  2N69 A;  4HE7 A;  5AQR A;  1NRA A;  3FZL A;  3M3Z A;  5AQL A;  3ATV A;  5AQO A;  5EXW A;  1ZFU A;  5EVZ A;  2V7Z A;  3AY9 A;  3JXU A;  5CY0 A;  1BMR A;  5BN8 A;  1C55 A;  1I2U A;  3GKU A;  5EX5 A;  1JZB A;  3R2V A;  5AQS A;  1NGE A;  1NGA A;  2A7T A;  3KP1 A;  5AQX A;  5AQH A;  3L4I A;  1JXC A;  1P0A A;  1GPT A;  5AR0 A;  2GL1 A;  2LN8 A;  3D2F B;  1NGF A;  1KAY A;  1LQQ A;  1QQM A;  1T7E A;  2MN5 A;  3L56 A;  3LDQ A;  4FSV A;  1WWN A;  4UAE F;  5F0X A;  3FZK A;  3LDL A;  3C7N A;  2YIP A;  3GL1 A;  2QWQ A;  1LQH A;  2QW9 A;  2GMO A;  4KYP A;  1LQI A;  2YIL A;  1NGD A;  4UAF E;  1T0Z A;  1N4N A;  2KHO A;  1SEG A;  3KOX A;  5AQQ A;  5AQM A;  4KBO A;  1OMY A;  2E0H A;  2KBJ A;  1I6G A;  2LKB A;  3KOZ A;  3ATU A;  3E7R L;  1BA0 A;  3KHW A;  2YIO A;  1YUW A;  1S3X A;  3CW4 A;  2LI7 A;  1TI5 A;  1CHZ A;  1DJT A;  1PE4 A;  2KPY A;  1WMT A;  1K8B A;  4GNI A;  2KGQ A;  2KSK A;  1XRS B;  1BRZ A; 
#chains in the Genus database with same CATH homology
 2YEO A;  3E7U X;  2YBR C;  1C56 A;  1P00 A;  1SN4 A;  2M8B B;  1L4V A;  2KYQ A;  2E3G A;  1T1T A;  1PTX A;  1T7B A;  2SN3 A;  2LR3 A;  4V1D C;  2NY8 X;  2B68 A;  2N2Q A;  1NH5 A;  1KV0 A;  4CQK A;  2N66 A;  1DQ7 A;  2KJA A;  1SN1 A;  2ASC A;  1CN2 A;  2YC1 C;  5KK4 A;  1NE5 A;  1B3C A;  4AB0 A;  1GPS A;  1MR4 A;  1VNA A;  1WT7 A;  1ZUT A;  1ZVG A;  1AYJ A;  2N2R A;  4AEI A;  1B7D A;  1JZA A;  2KBH A;  2LY5 A;  1ZVE A;  1ZYW A;  2I61 A;  2E3F A;  1I6F A;  1OZZ A;  4HHF A;  2BRZ A;  1AHO A;  2LT8 A;  1BCG A;  3PSM A;  4AAZ A;  1JKZ A;  2LY6 A;  1SNB A;  2MZ0 A;  1MYN A;  1I2V A;  2KBK A;  2LJ7 A;  1ICA A;  1ZYV A;  2B3C A;  1ZU3 A;  2NY9 X;  1FH3 A;  4UJ0 A;  1NRB A;  1VNB A;  1PX9 A;  2ATB A;  1T7A A;  1NPI A;  2LJM A;  1BK8 A;  2N69 A;  4HE7 A;  1NRA A;  1BMR A;  1ZFU A;  1C55 A;  5CY0 A;  1I2U A;  1JZB A;  2A7T A;  1JXC A;  1P0A A;  1GPT A;  2GL1 A;  1LQQ A;  1T7E A;  1WWN A;  1LQH A;  4KYP A;  1LQI A;  1T0Z A;  1N4N A;  1SEG A;  1OMY A;  2E0H A;  2KBJ A;  1I6G A;  2LKB A;  3E7R L;  2LI7 A;  1TI5 A;  1CHZ A;  1DJT A;  1PE4 A;  2KPY A;  1WMT A;  2KGQ A;  2KSK A;  1BRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...