1P0AA

Nmr structure of etd135, mutant of the antifungal defensin ard1 from archaeoprepona demophon
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
44
structure length
44
Chain Sequence
DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFLNVNCWCET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEFENSIN ARD1
publication title Lead optimization of antifungal peptides with 3D NMR structures analysis.
pubmed doi rcsb
source organism Archaeoprepona demophon
molecule tags Antifungal protein
total genus 8
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2003-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1p0aA00
1DQ7A 1T7AA 1JZAA 2E3FA 2YC1C 1PTXA 1FH3A 2A7TA 1P0AA 2B68A 2KBJA 1OZZA 2LY6A 2YEOA 5CY0A 1N4NA 3PSMA 2LR3A 1GPTA 1T7BA 1CN2A 5KK4A 4UJ0A 1NRAA 1MYNA 1ICAA 2SN3A 1WWNA 1NRBA 1LQQA 1NPIA 2KBHA 2B3CA 1BCGA 1PE4A 1SEGA 2KJAA 2LJMA 2YBRC 1KV0A 3E7RL 2NY8X 2LT8A 1C56A 2LJ7A 4AEIA 2ASCA 1BMRA 1DJTA 4V1DC 1B3CA 1ZYVA 2N66A 4HHFA 3E7UX 4KYPA 1BK8A 1AYJA 4AB0A 1T7EA 1OMYA 1AHOA 1L4VA 1T0ZA 4CQKA 1MR4A 1BRZA 1ZVGA 1VNBA 1WMTA 2KYQA 1ZU3A 1I2UA 1PX9A 2KSKA 1ZUTA 2GL1A 1LQIA 2ATBA 2E3GA 1SNBA 2LY5A 2N2RA 1TI5A 4HE7A 2N2QA 4AAZA 1B7DA 1P00A 1JXCA 2MZ0A 1ZYWA 1JZBA 1NE5A 2LKBA 1ZFUA 2I61A 2KPYA 2NY9X 1I6FA 1NH5A 2BRZA 2M8BB 2N69A 1JKZA 1I6GA 1C55A 1VNAA 1WT7A 2KBKA 1CHZA 1T1TA 2E0HA 1GPSA 2LI7A 2KGQA 1SN1A 1ZVEA 1SN4A 1LQHA 1I2VA
chains in the Genus database with same CATH superfamily
5AQZA 1KAZA 5AQTA 2E2FA 1DQ7A 1T7AA 1JZAA 4IO8A 2E3FA 2YC1C 1PTXA 2QWNA 3CW4A 5AQKA 1FH3A 3FE1A 4H5VA 5AQSA 2A7TA 1P0AA 2B68A 2KBJA 1OZZA 3KVGA 3QI7A 1HX1A 2LY6A 3GDQA 2YEOA 1XRSB 3SF4D 3KP0A 5AQUA 5CY0A 3GKUA 1KAXA 1S3XA 2D56A 1N4NA 5FPEA 4UAEF 1QQNA 3PSMA 2LR3A 1NGEA 1T7BA 3D2FB 5AQVA 5FPDA 5BPMA 1CN2A 3M3ZA 1GPTA 1KAYA 5KK4A 1NGJA 1NRAA 4UJ0A 1BA0A 1MYNA 2QXLA 3FZFA 1ICAA 2SN3A 5AQIA 5AQMA 5AQNA 2KHOA 1WWNA 3AY9A 4UAFE 1QQOA 1NGHA 1DKGD 3KOYA 5AQGA 2MBKA 1NRBA 2YILA 1LQQA 1NPIA 2KBHA 2B3CA 1BCGA 1PE4A 1SEGA 2KJAA 2LJMA 2YBRC 3LDOA 3LDLA 4H5RA 1KV0A 5EXWA 3E7RL 5EX5A 2QWOA 2NY8X 3GL1A 2LT8A 2E8AA 5AQRA 1C56A 2LJ7A 1BUPA 4AEIA 1K8BA 2ASCA 3ATUA 3FZMA 5AQFA 1UGLA 1DJTA 1BMRA 4V1DC 3FZHA 1B3CA 4FL9A 5AQHA 1ZYVA 2N66A 2E88A 5AQWA 4HHFA 3E7UX 4KYPA 1BK8A 1NGFA 4H5WA 1AYJA 3C7NA 5AR0A 4AB0A 2YIOA 5AQOA 1T7EA 3L4IA 2YIPA 3D2EA 1OMYA 2MN5A 1AHOA 4KBOA 5AQLA 1L4VA 3L6QA 1T0ZA 4CQKA 2G2KA 1MR4A 1BRZA 1ATSA 1ZVGA 4FSVA 3R2VA 2K35A 5AQJA 1VNBA 1WMTA 2KYQA 1ZU3A 1ATRA 1I2UA 1BA1A 2LN8A 1PX9A 3QFPA 4H5NA 5BN9A 5BPNA 4HWIA 2KSKA 5F2RA 1NGDA 3FZKA 4GNIA 1ZUTA 1QQMA 1LQIA 2GL1A 3FZLA 3KC6A 1YUWA 1HPMA 1NGBA 2QWMA 2QWPA 4H5TA 2ATBA 2E3GA 1SNBA 2LY5A 3C7NB 3JXUA 5AQXA 2N2RA 2BUPA 1NGIA 3D2EB 1TI5A 2GMOA 4HE7A 2N2QA 2QWRA 5FPMA 3LDNA 3LDPA 1B7DA 1NGAA 1P00A 2QW9A 4AAZA 5F0XA 3KHWA 5FPNA 1JXCA 3QMLA 3L56A 3KOZA 3LDQA 3HSCA 2MZ0A 5F1XA 3IUCA 1ZYWA 5BN8A 1JZBA 1NE5A 3QFUA 2LKBA 1ZFUA 3A8YA 2JDQD 5EY4A 2I61A 2KPYA 1NGCA 3ATVA 2NY9X 3KOWA 5AQPA 1I6FA 1NH5A 2BRZA 2M8BB 3I33A 3CQXA 3D2FA 2N69A 1JKZA 2VY6A 5BPLA 1I6GA 1POIA 3KOXA 3BK3C 3KP1A 4UADE 1NGGA 1VNAA 1WT7A 5AQQA 1C55A 2V7ZA 2KBKA 1CHZA 1T1TA 2E0HA 5AQYA 1GPSA 2LI7A 2KGQA 1SN1A 1ZVEA 1SN4A 1LQHA 1HJOA 5EVZA 2QWQA 2QWLA 1I2VA
chains in the Genus database with same CATH topology
1DQ7A 1T7AA 1JZAA 2E3FA 2YC1C 1PTXA 1FH3A 2A7TA 1P0AA 2B68A 2KBJA 1OZZA 2LY6A 2YEOA 5CY0A 1N4NA 3PSMA 2LR3A 1GPTA 1T7BA 1CN2A 5KK4A 4UJ0A 1NRAA 1MYNA 1ICAA 2SN3A 1WWNA 1NRBA 1LQQA 1NPIA 2KBHA 2B3CA 1BCGA 1PE4A 1SEGA 2KJAA 2LJMA 2YBRC 1KV0A 3E7RL 2NY8X 2LT8A 1C56A 2LJ7A 4AEIA 2ASCA 1BMRA 1DJTA 4V1DC 1B3CA 1ZYVA 2N66A 4HHFA 3E7UX 4KYPA 1BK8A 1AYJA 4AB0A 1T7EA 1OMYA 1AHOA 1L4VA 1T0ZA 4CQKA 1MR4A 1BRZA 1ZVGA 1VNBA 1WMTA 2KYQA 1ZU3A 1I2UA 1PX9A 2KSKA 1ZUTA 2GL1A 1LQIA 2ATBA 2E3GA 1SNBA 2LY5A 2N2RA 1TI5A 4HE7A 2N2QA 4AAZA 1B7DA 1P00A 1JXCA 2MZ0A 1ZYWA 1JZBA 1NE5A 2LKBA 1ZFUA 2I61A 2KPYA 2NY9X 1I6FA 1NH5A 2BRZA 2M8BB 2N69A 1JKZA 1I6GA 1C55A 1VNAA 1WT7A 2KBKA 1CHZA 1T1TA 2E0HA 1GPSA 2LI7A 2KGQA 1SN1A 1ZVEA 1SN4A 1LQHA 1I2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DQ7 A;  1T7A A;  1JZA A;  2E3F A;  2YC1 C;  1PTX A;  1FH3 A;  2A7T A;  1P0A A;  2B68 A;  2KBJ A;  1OZZ A;  2LY6 A;  2YEO A;  5CY0 A;  1N4N A;  3PSM A;  2LR3 A;  1GPT A;  1T7B A;  1CN2 A;  5KK4 A;  4UJ0 A;  1NRA A;  1MYN A;  1ICA A;  2SN3 A;  1WWN A;  1NRB A;  1LQQ A;  1NPI A;  2KBH A;  2B3C A;  1BCG A;  1PE4 A;  1SEG A;  2KJA A;  2LJM A;  2YBR C;  1KV0 A;  3E7R L;  2NY8 X;  2LT8 A;  1C56 A;  2LJ7 A;  4AEI A;  2ASC A;  1BMR A;  1DJT A;  4V1D C;  1B3C A;  1ZYV A;  2N66 A;  4HHF A;  3E7U X;  4KYP A;  1BK8 A;  1AYJ A;  4AB0 A;  1T7E A;  1OMY A;  1AHO A;  1L4V A;  1T0Z A;  4CQK A;  1MR4 A;  1BRZ A;  1ZVG A;  1VNB A;  1WMT A;  2KYQ A;  1ZU3 A;  1I2U A;  1PX9 A;  2KSK A;  1ZUT A;  2GL1 A;  1LQI A;  2ATB A;  2E3G A;  1SNB A;  2LY5 A;  2N2R A;  1TI5 A;  4HE7 A;  2N2Q A;  4AAZ A;  1B7D A;  1P00 A;  1JXC A;  2MZ0 A;  1ZYW A;  1JZB A;  1NE5 A;  2LKB A;  1ZFU A;  2I61 A;  2KPY A;  2NY9 X;  1I6F A;  1NH5 A;  2BRZ A;  2M8B B;  2N69 A;  1JKZ A;  1I6G A;  1C55 A;  1VNA A;  1WT7 A;  2KBK A;  1CHZ A;  1T1T A;  2E0H A;  1GPS A;  2LI7 A;  2KGQ A;  1SN1 A;  1ZVE A;  1SN4 A;  1LQH A;  1I2V A; 
#chains in the Genus database with same CATH topology
 5AQZ A;  1KAZ A;  5AQT A;  2E2F A;  1DQ7 A;  1T7A A;  1JZA A;  4IO8 A;  2E3F A;  2YC1 C;  1PTX A;  2QWN A;  3CW4 A;  5AQK A;  1FH3 A;  3FE1 A;  4H5V A;  5AQS A;  2A7T A;  1P0A A;  2B68 A;  2KBJ A;  1OZZ A;  3KVG A;  3QI7 A;  1HX1 A;  2LY6 A;  3GDQ A;  2YEO A;  1XRS B;  3SF4 D;  3KP0 A;  5AQU A;  5CY0 A;  3GKU A;  1KAX A;  1S3X A;  2D56 A;  1N4N A;  5FPE A;  4UAE F;  1QQN A;  3PSM A;  2LR3 A;  1NGE A;  1T7B A;  3D2F B;  5AQV A;  5FPD A;  5BPM A;  1CN2 A;  3M3Z A;  1GPT A;  1KAY A;  5KK4 A;  1NGJ A;  1NRA A;  4UJ0 A;  1BA0 A;  1MYN A;  2QXL A;  3FZF A;  1ICA A;  2SN3 A;  5AQI A;  5AQM A;  5AQN A;  2KHO A;  1WWN A;  3AY9 A;  4UAF E;  1QQO A;  1NGH A;  1DKG D;  3KOY A;  5AQG A;  2MBK A;  1NRB A;  2YIL A;  1LQQ A;  1NPI A;  2KBH A;  2B3C A;  1BCG A;  1PE4 A;  1SEG A;  2KJA A;  2LJM A;  2YBR C;  3LDO A;  3LDL A;  4H5R A;  1KV0 A;  5EXW A;  3E7R L;  5EX5 A;  2QWO A;  2NY8 X;  3GL1 A;  2LT8 A;  2E8A A;  5AQR A;  1C56 A;  2LJ7 A;  1BUP A;  4AEI A;  1K8B A;  2ASC A;  3ATU A;  3FZM A;  5AQF A;  1UGL A;  1DJT A;  1BMR A;  4V1D C;  3FZH A;  1B3C A;  4FL9 A;  5AQH A;  1ZYV A;  2N66 A;  2E88 A;  5AQW A;  4HHF A;  3E7U X;  4KYP A;  1BK8 A;  1NGF A;  4H5W A;  1AYJ A;  3C7N A;  5AR0 A;  4AB0 A;  2YIO A;  5AQO A;  1T7E A;  3L4I A;  2YIP A;  3D2E A;  1OMY A;  2MN5 A;  1AHO A;  4KBO A;  5AQL A;  1L4V A;  3L6Q A;  1T0Z A;  4CQK A;  2G2K A;  1MR4 A;  1BRZ A;  1ATS A;  1ZVG A;  4FSV A;  3R2V A;  2K35 A;  5AQJ A;  1VNB A;  1WMT A;  2KYQ A;  1ZU3 A;  1ATR A;  1I2U A;  1BA1 A;  2LN8 A;  1PX9 A;  3QFP A;  4H5N A;  5BN9 A;  5BPN A;  4HWI A;  2KSK A;  5F2R A;  1NGD A;  3FZK A;  4GNI A;  1ZUT A;  1QQM A;  1LQI A;  2GL1 A;  3FZL A;  3KC6 A;  1YUW A;  1HPM A;  1NGB A;  2QWM A;  2QWP A;  4H5T A;  2ATB A;  2E3G A;  1SNB A;  2LY5 A;  3C7N B;  3JXU A;  5AQX A;  2N2R A;  2BUP A;  1NGI A;  3D2E B;  1TI5 A;  2GMO A;  4HE7 A;  2N2Q A;  2QWR A;  5FPM A;  3LDN A;  3LDP A;  1B7D A;  1NGA A;  1P00 A;  2QW9 A;  4AAZ A;  5F0X A;  3KHW A;  5FPN A;  1JXC A;  3QML A;  3L56 A;  3KOZ A;  3LDQ A;  3HSC A;  2MZ0 A;  5F1X A;  3IUC A;  1ZYW A;  5BN8 A;  1JZB A;  1NE5 A;  3QFU A;  2LKB A;  1ZFU A;  3A8Y A;  2JDQ D;  5EY4 A;  2I61 A;  2KPY A;  1NGC A;  3ATV A;  2NY9 X;  3KOW A;  5AQP A;  1I6F A;  1NH5 A;  2BRZ A;  2M8B B;  3I33 A;  3CQX A;  3D2F A;  2N69 A;  1JKZ A;  2VY6 A;  5BPL A;  1I6G A;  1POI A;  3KOX A;  3BK3 C;  3KP1 A;  4UAD E;  1NGG A;  1VNA A;  1WT7 A;  5AQQ A;  1C55 A;  2V7Z A;  2KBK A;  1CHZ A;  1T1T A;  2E0H A;  5AQY A;  1GPS A;  2LI7 A;  2KGQ A;  1SN1 A;  1ZVE A;  1SN4 A;  1LQH A;  1HJO A;  5EVZ A;  2QWQ A;  2QWL A;  1I2V A; 
#chains in the Genus database with same CATH homology
 1DQ7 A;  1T7A A;  1JZA A;  2E3F A;  2YC1 C;  1PTX A;  1FH3 A;  2A7T A;  1P0A A;  2B68 A;  2KBJ A;  1OZZ A;  2LY6 A;  2YEO A;  5CY0 A;  1N4N A;  3PSM A;  2LR3 A;  1GPT A;  1T7B A;  1CN2 A;  5KK4 A;  4UJ0 A;  1NRA A;  1MYN A;  1ICA A;  2SN3 A;  1WWN A;  1NRB A;  1LQQ A;  1NPI A;  2KBH A;  2B3C A;  1BCG A;  1PE4 A;  1SEG A;  2KJA A;  2LJM A;  2YBR C;  1KV0 A;  3E7R L;  2NY8 X;  2LT8 A;  1C56 A;  2LJ7 A;  4AEI A;  2ASC A;  1BMR A;  1DJT A;  4V1D C;  1B3C A;  1ZYV A;  2N66 A;  4HHF A;  3E7U X;  4KYP A;  1BK8 A;  1AYJ A;  4AB0 A;  1T7E A;  1OMY A;  1AHO A;  1L4V A;  1T0Z A;  4CQK A;  1MR4 A;  1BRZ A;  1ZVG A;  1VNB A;  1WMT A;  2KYQ A;  1ZU3 A;  1I2U A;  1PX9 A;  2KSK A;  1ZUT A;  2GL1 A;  1LQI A;  2ATB A;  2E3G A;  1SNB A;  2LY5 A;  2N2R A;  1TI5 A;  4HE7 A;  2N2Q A;  4AAZ A;  1B7D A;  1P00 A;  1JXC A;  2MZ0 A;  1ZYW A;  1JZB A;  1NE5 A;  2LKB A;  1ZFU A;  2I61 A;  2KPY A;  2NY9 X;  1I6F A;  1NH5 A;  2BRZ A;  2M8B B;  2N69 A;  1JKZ A;  1I6G A;  1C55 A;  1VNA A;  1WT7 A;  2KBK A;  1CHZ A;  1T1T A;  2E0H A;  1GPS A;  2LI7 A;  2KGQ A;  1SN1 A;  1ZVE A;  1SN4 A;  1LQH A;  1I2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...