1LQIA

Insecticidal alpha scorpion toxin isolated from the venom of scorpion leiurus quinquestriatus hebraeus, nmr, 29 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
b'MVRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INSECT TOXIN ALPHA
publication title Solution structures of a highly insecticidal recombinant scorpion alpha-toxin and a mutant with increased activity.
pubmed doi rcsb
source organism Leiurus quinquestriatus hebraeus
molecule tags Neurotoxin
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1996-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1lqiA00
1DQ7A 1MYNA 2LKBA 4V1DC 2LR3A 1ZVGA 2GL1A 1C55A 1T0ZA 1KV0A 1L4VA 1LQHA 1FH3A 1JZBA 2KPYA 1ZYWA 1I6FA 4UJ0A 3E7RL 1CN2A 2YBRC 2KBJA 1NRAA 2N2QA 1NPIA 1TI5A 1WMTA 1VNBA 1SEGA 2NY9X 2LI7A 2ASCA 1PTXA 2KGQA 2N69A 1ZVEA 2B68A 1PE4A 2YC1C 1WT7A 1NE5A 1T7BA 2LY6A 1AYJA 1LQIA 2SN3A 1P00A 2E3GA 3PSMA 2LY5A 2E3FA 1P0AA 2LJ7A 4CQKA 1GPTA 4AB0A 1ICAA 1B7DA 1JXCA 1PX9A 1GPSA 1VNAA 2NY8X 1T7AA 2A7TA 2KBHA 2LT8A 2KBKA 2E0HA 1C56A 5CY0A 1B3CA 1T7EA 3E7UX 2I61A 4AAZA 4HE7A 1N4NA 2KYQA 2MZ0A 5KK4A 2N66A 2N2RA 1NRBA 1T1TA 2LJMA 1BRZA 1CHZA 2ATBA 4KYPA 1ZYVA 2KJAA 1SN1A 2M8BB 2KSKA 1BK8A 1SNBA 4AEIA 1MR4A 4HHFA 1BCGA 1DJTA 1BMRA 1JKZA 1SN4A 1I6GA 1OZZA 1I2VA 1WWNA 2YEOA 1I2UA 1NH5A 1ZU3A 1JZAA 2B3CA 1LQQA 1ZFUA 2BRZA 1AHOA 1OMYA 1ZUTA
chains in the Genus database with same CATH superfamily
1DQ7A 2QWNA 1MYNA 3LDOA 2LKBA 3KOXA 4HWIA 1NGEA 3FZLA 4V1DC 3CQXA 2LR3A 1ZVGA 5KK4A 2GL1A 3I33A 3KP0A 1C55A 1T0ZA 2JDQD 1KV0A 3L4IA 1L4VA 1LQHA 1FH3A 1JZBA 1NGAA 2KPYA 1ZYWA 1I6FA 4UJ0A 5F0XA 3KC6A 3E7RL 1NGGA 1BA1A 1CN2A 2YBRC 2KBJA 1POIA 1NRAA 2N2QA 3FZHA 1NGJA 1NPIA 1TI5A 1VNBA 1WMTA 3BK3C 3KVGA 1SEGA 5BPLA 5AQMA 3GDQA 2NY9X 2YILA 2V7ZA 1ATSA 2LI7A 2ASCA 4H5TA 1PTXA 5BPNA 2KGQA 5AQPA 2N69A 3A8YA 4H5RA 1NGCA 1DKGD 1QQOA 1KAXA 2QWPA 3JXUA 1ZVEA 2QXLA 5FPEA 3D2FB 3D2FA 2B68A 1PE4A 2YC1C 2VY6A 2MBKA 5BN8A 3ATUA 1NGIA 1WT7A 1NE5A 1T7BA 2LY6A 3KOYA 5AQJA 5AR0A 1NGDA 3KOWA 5AQYA 1AYJA 3FZMA 1LQIA 2SN3A 5EX5A 5FPNA 5AQVA 1P00A 2E3GA 2MN5A 5EY4A 3PSMA 3LDLA 1XRSB 1HPMA 2K35A 2LY5A 2E3FA 1P0AA 5FPMA 2LJ7A 2QWRA 5EVZA 4CQKA 4KBOA 2GMOA 3M3ZA 4FL9A 1NGFA 5AQKA 2QWQA 4UAFE 1GPTA 4AB0A 1ICAA 1NGBA 1B7DA 1JXCA 1PX9A 2KHOA 5AQIA 5AQNA 1GPSA 1NGHA 3HSCA 1VNAA 2NY8X 5AQLA 5AQWA 4H5WA 1T7AA 2A7TA 2KBHA 5AQRA 3SF4D 2LT8A 2KBKA 2E0HA 1C56A 3GL1A 5CY0A 1B3CA 1T7EA 2D56A 1ATRA 3D2EA 2QWOA 2YIPA 2I61A 3E7UX 4AAZA 5EXWA 1UGLA 5BPMA 3FE1A 4HE7A 5FPDA 1N4NA 3L6QA 3QMLA 4H5NA 5AQQA 5AQGA 2KYQA 2E8AA 2MZ0A 2G2KA 2N66A 2N2RA 3L56A 4IO8A 5AQSA 1NRBA 1T1TA 2QW9A 2LJMA 3FZKA 1BRZA 1CHZA 2ATBA 1BUPA 4KYPA 3LDQA 5AQXA 5F1XA 1ZYVA 2KJAA 2LN8A 1SN1A 1KAZA 5BN9A 2M8BB 4UADE 1BA0A 2KSKA 5AQZA 4H5VA 1BK8A 2E2FA 1SNBA 5AQTA 3IUCA 4FSVA 4AEIA 1MR4A 3LDNA 3ATVA 4HHFA 3QFUA 3KP1A 1BCGA 1DJTA 1S3XA 3QI7A 3R2VA 1BMRA 1JKZA 3QFPA 1SN4A 2BUPA 1HX1A 3KHWA 1I6GA 1OZZA 1I2VA 3D2EB 2E88A 2QWLA 2YIOA 1HJOA 1WWNA 5AQHA 5AQUA 2YEOA 3KOZA 2QWMA 5F2RA 3FZFA 3GKUA 5AQOA 1QQMA 1YUWA 1I2UA 1NH5A 1ZU3A 1JZAA 4GNIA 3LDPA 1KAYA 3CW4A 2B3CA 5AQFA 1K8BA 1LQQA 3C7NB 3C7NA 1ZFUA 1QQNA 2BRZA 3AY9A 4UAEF 1AHOA 1OMYA 1ZUTA
chains in the Genus database with same CATH topology
1DQ7A 1MYNA 2LKBA 4V1DC 2LR3A 1ZVGA 2GL1A 1C55A 1T0ZA 1KV0A 1L4VA 1LQHA 1FH3A 1JZBA 2KPYA 1ZYWA 1I6FA 4UJ0A 3E7RL 1CN2A 2YBRC 2KBJA 1NRAA 2N2QA 1NPIA 1TI5A 1WMTA 1VNBA 1SEGA 2NY9X 2LI7A 2ASCA 1PTXA 2KGQA 2N69A 1ZVEA 2B68A 1PE4A 2YC1C 1WT7A 1NE5A 1T7BA 2LY6A 1AYJA 1LQIA 2SN3A 1P00A 2E3GA 3PSMA 2LY5A 2E3FA 1P0AA 2LJ7A 4CQKA 1GPTA 4AB0A 1ICAA 1B7DA 1JXCA 1PX9A 1GPSA 1VNAA 2NY8X 1T7AA 2A7TA 2KBHA 2LT8A 2KBKA 2E0HA 1C56A 5CY0A 1B3CA 1T7EA 3E7UX 2I61A 4AAZA 4HE7A 1N4NA 2KYQA 2MZ0A 5KK4A 2N66A 2N2RA 1NRBA 1T1TA 2LJMA 1BRZA 1CHZA 2ATBA 4KYPA 1ZYVA 2KJAA 1SN1A 2M8BB 2KSKA 1BK8A 1SNBA 4AEIA 1MR4A 4HHFA 1BCGA 1DJTA 1BMRA 1JKZA 1SN4A 1I6GA 1OZZA 1I2VA 1WWNA 2YEOA 1I2UA 1NH5A 1ZU3A 1JZAA 2B3CA 1LQQA 1ZFUA 2BRZA 1AHOA 1OMYA 1ZUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DQ7 A;  1MYN A;  2LKB A;  4V1D C;  2LR3 A;  1ZVG A;  2GL1 A;  1C55 A;  1T0Z A;  1KV0 A;  1L4V A;  1LQH A;  1FH3 A;  1JZB A;  2KPY A;  1ZYW A;  1I6F A;  4UJ0 A;  3E7R L;  1CN2 A;  2YBR C;  2KBJ A;  1NRA A;  2N2Q A;  1NPI A;  1TI5 A;  1WMT A;  1VNB A;  1SEG A;  2NY9 X;  2LI7 A;  2ASC A;  1PTX A;  2KGQ A;  2N69 A;  1ZVE A;  2B68 A;  1PE4 A;  2YC1 C;  1WT7 A;  1NE5 A;  1T7B A;  2LY6 A;  1AYJ A;  1LQI A;  2SN3 A;  1P00 A;  2E3G A;  3PSM A;  2LY5 A;  2E3F A;  1P0A A;  2LJ7 A;  4CQK A;  1GPT A;  4AB0 A;  1ICA A;  1B7D A;  1JXC A;  1PX9 A;  1GPS A;  1VNA A;  2NY8 X;  1T7A A;  2A7T A;  2KBH A;  2LT8 A;  2KBK A;  2E0H A;  1C56 A;  5CY0 A;  1B3C A;  1T7E A;  3E7U X;  2I61 A;  4AAZ A;  4HE7 A;  1N4N A;  2KYQ A;  2MZ0 A;  5KK4 A;  2N66 A;  2N2R A;  1NRB A;  1T1T A;  2LJM A;  1BRZ A;  1CHZ A;  2ATB A;  4KYP A;  1ZYV A;  2KJA A;  1SN1 A;  2M8B B;  2KSK A;  1BK8 A;  1SNB A;  4AEI A;  1MR4 A;  4HHF A;  1BCG A;  1DJT A;  1BMR A;  1JKZ A;  1SN4 A;  1I6G A;  1OZZ A;  1I2V A;  1WWN A;  2YEO A;  1I2U A;  1NH5 A;  1ZU3 A;  1JZA A;  2B3C A;  1LQQ A;  1ZFU A;  2BRZ A;  1AHO A;  1OMY A;  1ZUT A; 
#chains in the Genus database with same CATH topology
 1DQ7 A;  2QWN A;  1MYN A;  3LDO A;  2LKB A;  3KOX A;  4HWI A;  1NGE A;  3FZL A;  4V1D C;  3CQX A;  2LR3 A;  1ZVG A;  5KK4 A;  2GL1 A;  3I33 A;  3KP0 A;  1C55 A;  1T0Z A;  2JDQ D;  1KV0 A;  3L4I A;  1L4V A;  1LQH A;  1FH3 A;  1JZB A;  1NGA A;  2KPY A;  1ZYW A;  1I6F A;  4UJ0 A;  5F0X A;  3KC6 A;  3E7R L;  1NGG A;  1BA1 A;  1CN2 A;  2YBR C;  2KBJ A;  1POI A;  1NRA A;  2N2Q A;  3FZH A;  1NGJ A;  1NPI A;  1TI5 A;  1VNB A;  1WMT A;  3BK3 C;  3KVG A;  1SEG A;  5BPL A;  5AQM A;  3GDQ A;  2NY9 X;  2YIL A;  2V7Z A;  1ATS A;  2LI7 A;  2ASC A;  4H5T A;  1PTX A;  5BPN A;  2KGQ A;  5AQP A;  2N69 A;  3A8Y A;  4H5R A;  1NGC A;  1DKG D;  1QQO A;  1KAX A;  2QWP A;  3JXU A;  1ZVE A;  2QXL A;  5FPE A;  3D2F B;  3D2F A;  2B68 A;  1PE4 A;  2YC1 C;  2VY6 A;  2MBK A;  5BN8 A;  3ATU A;  1NGI A;  1WT7 A;  1NE5 A;  1T7B A;  2LY6 A;  3KOY A;  5AQJ A;  5AR0 A;  1NGD A;  3KOW A;  5AQY A;  1AYJ A;  3FZM A;  1LQI A;  2SN3 A;  5EX5 A;  5FPN A;  5AQV A;  1P00 A;  2E3G A;  2MN5 A;  5EY4 A;  3PSM A;  3LDL A;  1XRS B;  1HPM A;  2K35 A;  2LY5 A;  2E3F A;  1P0A A;  5FPM A;  2LJ7 A;  2QWR A;  5EVZ A;  4CQK A;  4KBO A;  2GMO A;  3M3Z A;  4FL9 A;  1NGF A;  5AQK A;  2QWQ A;  4UAF E;  1GPT A;  4AB0 A;  1ICA A;  1NGB A;  1B7D A;  1JXC A;  1PX9 A;  2KHO A;  5AQI A;  5AQN A;  1GPS A;  1NGH A;  3HSC A;  1VNA A;  2NY8 X;  5AQL A;  5AQW A;  4H5W A;  1T7A A;  2A7T A;  2KBH A;  5AQR A;  3SF4 D;  2LT8 A;  2KBK A;  2E0H A;  1C56 A;  3GL1 A;  5CY0 A;  1B3C A;  1T7E A;  2D56 A;  1ATR A;  3D2E A;  2QWO A;  2YIP A;  2I61 A;  3E7U X;  4AAZ A;  5EXW A;  1UGL A;  5BPM A;  3FE1 A;  4HE7 A;  5FPD A;  1N4N A;  3L6Q A;  3QML A;  4H5N A;  5AQQ A;  5AQG A;  2KYQ A;  2E8A A;  2MZ0 A;  2G2K A;  2N66 A;  2N2R A;  3L56 A;  4IO8 A;  5AQS A;  1NRB A;  1T1T A;  2QW9 A;  2LJM A;  3FZK A;  1BRZ A;  1CHZ A;  2ATB A;  1BUP A;  4KYP A;  3LDQ A;  5AQX A;  5F1X A;  1ZYV A;  2KJA A;  2LN8 A;  1SN1 A;  1KAZ A;  5BN9 A;  2M8B B;  4UAD E;  1BA0 A;  2KSK A;  5AQZ A;  4H5V A;  1BK8 A;  2E2F A;  1SNB A;  5AQT A;  3IUC A;  4FSV A;  4AEI A;  1MR4 A;  3LDN A;  3ATV A;  4HHF A;  3QFU A;  3KP1 A;  1BCG A;  1DJT A;  1S3X A;  3QI7 A;  3R2V A;  1BMR A;  1JKZ A;  3QFP A;  1SN4 A;  2BUP A;  1HX1 A;  3KHW A;  1I6G A;  1OZZ A;  1I2V A;  3D2E B;  2E88 A;  2QWL A;  2YIO A;  1HJO A;  1WWN A;  5AQH A;  5AQU A;  2YEO A;  3KOZ A;  2QWM A;  5F2R A;  3FZF A;  3GKU A;  5AQO A;  1QQM A;  1YUW A;  1I2U A;  1NH5 A;  1ZU3 A;  1JZA A;  4GNI A;  3LDP A;  1KAY A;  3CW4 A;  2B3C A;  5AQF A;  1K8B A;  1LQQ A;  3C7N B;  3C7N A;  1ZFU A;  1QQN A;  2BRZ A;  3AY9 A;  4UAE F;  1AHO A;  1OMY A;  1ZUT A; 
#chains in the Genus database with same CATH homology
 1DQ7 A;  1MYN A;  2LKB A;  4V1D C;  2LR3 A;  1ZVG A;  2GL1 A;  1C55 A;  1T0Z A;  1KV0 A;  1L4V A;  1LQH A;  1FH3 A;  1JZB A;  2KPY A;  1ZYW A;  1I6F A;  4UJ0 A;  3E7R L;  1CN2 A;  2YBR C;  2KBJ A;  1NRA A;  2N2Q A;  1NPI A;  1TI5 A;  1WMT A;  1VNB A;  1SEG A;  2NY9 X;  2LI7 A;  2ASC A;  1PTX A;  2KGQ A;  2N69 A;  1ZVE A;  2B68 A;  1PE4 A;  2YC1 C;  1WT7 A;  1NE5 A;  1T7B A;  2LY6 A;  1AYJ A;  1LQI A;  2SN3 A;  1P00 A;  2E3G A;  3PSM A;  2LY5 A;  2E3F A;  1P0A A;  2LJ7 A;  4CQK A;  1GPT A;  4AB0 A;  1ICA A;  1B7D A;  1JXC A;  1PX9 A;  1GPS A;  1VNA A;  2NY8 X;  1T7A A;  2A7T A;  2KBH A;  2LT8 A;  2KBK A;  2E0H A;  1C56 A;  5CY0 A;  1B3C A;  1T7E A;  3E7U X;  2I61 A;  4AAZ A;  4HE7 A;  1N4N A;  2KYQ A;  2MZ0 A;  5KK4 A;  2N66 A;  2N2R A;  1NRB A;  1T1T A;  2LJM A;  1BRZ A;  1CHZ A;  2ATB A;  4KYP A;  1ZYV A;  2KJA A;  1SN1 A;  2M8B B;  2KSK A;  1BK8 A;  1SNB A;  4AEI A;  1MR4 A;  4HHF A;  1BCG A;  1DJT A;  1BMR A;  1JKZ A;  1SN4 A;  1I6G A;  1OZZ A;  1I2V A;  1WWN A;  2YEO A;  1I2U A;  1NH5 A;  1ZU3 A;  1JZA A;  2B3C A;  1LQQ A;  1ZFU A;  2BRZ A;  1AHO A;  1OMY A;  1ZUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...