1LQHA

Insecticidal alpha scorpion toxin isolated from the venom of scorpion leiurus quinquestriatus hebraeus, nmr, minimized average structure
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
MVRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Neurotoxin
molecule keywords INSECT TOXIN ALPHA
publication title Solution structures of a highly insecticidal recombinant scorpion alpha-toxin and a mutant with increased activity.
pubmed doi rcsb
source organism Leiurus quinquestriatus hebraeus
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1996-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1lqhA00
1JZBA 1JKZA 1ZFUA 2N2RA 1PX9A 3E7UX 1B7DA 1ZU3A 2YEOA 1TI5A 2LT8A 4HHFA 1T1TA 2KBJA 2N2QA 1I2VA 1P00A 1C55A 2KJAA 2I61A 1LQQA 2N66A 4AB0A 2KBHA 2KBKA 2YC1C 2BRZA 2MZ0A 2KYQA 4HE7A 1LQHA 1DQ7A 1NE5A 1B3CA 1NPIA 1VNAA 4AEIA 1T7AA 1ZVEA 4KYPA 1OZZA 4V1DC 2YBRC 1I6FA 1P0AA 2KGQA 1T7EA 1ZYVA 2M8BB 2LR3A 2LJ7A 1SN4A 2LKBA 1KV0A 1L4VA 1MYNA 2LY5A 2A7TA 2GL1A 2KPYA 4CQKA 1AHOA 4UJ0A 2KSKA 1SN1A 2N69A 1C56A 2SN3A 2LI7A 1CN2A 2E3FA 1WT7A 1CHZA 4AAZA 1DJTA 5KK4A 1SNBA 2B3CA 1JXCA 1AYJA 1NRBA 2LY6A 1I2UA 1GPSA 2LJMA 1OMYA 1JZAA 2ASCA 3PSMA 1NH5A 2E0HA 2NY9X 2NY8X 1BMRA 1ZYWA 1FH3A 1MR4A 1ICAA 1ZUTA 1I6GA 1PE4A 1VNBA 2B68A 1GPTA 1BK8A 1LQIA 1PTXA 1SEGA 1BRZA 2ATBA 1WMTA 1WWNA 1N4NA 1ZVGA 2E3GA 1BCGA 1NRAA 1T0ZA 5CY0A 1T7BA 3E7RL
chains in the Genus database with same CATH superfamily
2QW9A 1JZBA 3BK3C 5AQMA 5AQTA 1JKZA 2E8AA 3FZKA 2GMOA 1ZFUA 2N2RA 1PX9A 5F1XA 3E7UX 1B7DA 4H5NA 5AQRA 3KOWA 1ZU3A 2YEOA 1TI5A 1YUWA 2LT8A 4HHFA 1T1TA 2KBJA 2N2QA 1HPMA 2QWPA 2YIPA 1I2VA 1P00A 1C55A 5FPMA 1NGIA 2YILA 5EY4A 2KJAA 5AQSA 2I61A 1LQQA 2N66A 4AB0A 2KBHA 2KBKA 2VY6A 2YC1C 1ATSA 2BRZA 2MZ0A 2QWNA 3D2EB 5AQHA 5EVZA 2KYQA 2QWOA 4HE7A 1LQHA 5AQXA 3L4IA 1DQ7A 5FPEA 5FPDA 1NE5A 2QWRA 5AQFA 1XRSB 3D2EA 3QMLA 2G2KA 3FZFA 5BPNA 5AQQA 4UAEF 1B3CA 1NPIA 1VNAA 1BUPA 3KVGA 3LDLA 4AEIA 1T7AA 1ZVEA 4UAFE 2LN8A 4KYPA 2JDQD 5F0XA 1KAZA 1OZZA 3QFPA 2BUPA 2YBRC 3C7NA 1I6FA 4UADE 1P0AA 2KGQA 4V1DC 5BPMA 1T7EA 3ATVA 5EXWA 4H5WA 1ZYVA 1NGAA 1QQOA 2LR3A 2M8BB 3LDPA 5AQJA 5FPNA 2LJ7A 1POIA 1SN4A 2LKBA 1KV0A 1L4VA 1NGCA 3L6QA 1KAYA 1NGHA 2MBKA 1DKGD 1MYNA 3A8YA 4FL9A 5AQGA 2LY5A 2A7TA 3HSCA 2GL1A 2KPYA 4CQKA 4IO8A 5BN8A 1AHOA 4UJ0A 2KSKA 3KC6A 5AQNA 5AQZA 2QWMA 1SN1A 3R2VA 3CW4A 3KOYA 2N69A 1BA1A 3QFUA 2YIOA 4H5TA 3GL1A 1C56A 3JXUA 2SN3A 1KAXA 1NGEA 2LI7A 3I33A 1UGLA 2E3FA 2MN5A 1CN2A 1WT7A 3KP1A 1CHZA 3C7NB 4AAZA 1DJTA 5KK4A 1SNBA 2B3CA 1JXCA 5F2RA 1HJOA 1AYJA 1NRBA 5AQPA 2LY6A 5AQWA 4H5RA 2QXLA 3D2FA 1I2UA 1GPSA 1BA0A 2D56A 3LDNA 3KHWA 2E88A 2LJMA 3KOZA 1OMYA 1JZAA 2ASCA 2E2FA 3PSMA 1NH5A 3IUCA 2E0HA 2NY9X 2NY8X 3CQXA 3KP0A 1BMRA 1ZYWA 1NGBA 4FSVA 1FH3A 1HX1A 1MR4A 3AY9A 5EX5A 3FZMA 5AQLA 2QWQA 1ICAA 5AR0A 1QQMA 5BN9A 1ZUTA 2KHOA 1I6GA 1S3XA 4HWIA 3GDQA 1PE4A 1VNBA 2V7ZA 2B68A 3D2FB 3ATUA 3LDOA 1K8BA 3M3ZA 3FZLA 4KBOA 5BPLA 1GPTA 3FE1A 3L56A 4H5VA 5AQIA 5AQKA 1BK8A 1ATRA 1LQIA 5AQOA 4GNIA 1NGJA 1PTXA 3LDQA 2QWLA 5AQYA 1NGFA 1NGDA 1SEGA 5AQVA 3GKUA 3KOXA 1BRZA 2ATBA 1WMTA 1WWNA 5AQUA 1QQNA 1N4NA 3QI7A 3SF4D 1NGGA 1ZVGA 1BCGA 1NRAA 2E3GA 1T0ZA 5CY0A 3FZHA 1T7BA 3E7RL 2K35A
chains in the Genus database with same CATH topology
1JZBA 1JKZA 1ZFUA 2N2RA 1PX9A 3E7UX 1B7DA 1ZU3A 2YEOA 1TI5A 2LT8A 4HHFA 1T1TA 2KBJA 2N2QA 1I2VA 1P00A 1C55A 2KJAA 2I61A 1LQQA 2N66A 4AB0A 2KBHA 2KBKA 2YC1C 2BRZA 2MZ0A 2KYQA 4HE7A 1LQHA 1DQ7A 1NE5A 1B3CA 1NPIA 1VNAA 4AEIA 1T7AA 1ZVEA 4KYPA 1OZZA 4V1DC 2YBRC 1I6FA 1P0AA 2KGQA 1T7EA 1ZYVA 2M8BB 2LR3A 2LJ7A 1SN4A 2LKBA 1KV0A 1L4VA 1MYNA 2LY5A 2A7TA 2GL1A 2KPYA 4CQKA 1AHOA 4UJ0A 2KSKA 1SN1A 2N69A 1C56A 2SN3A 2LI7A 1CN2A 2E3FA 1WT7A 1CHZA 4AAZA 1DJTA 5KK4A 1SNBA 2B3CA 1JXCA 1AYJA 1NRBA 2LY6A 1I2UA 1GPSA 2LJMA 1OMYA 1JZAA 2ASCA 3PSMA 1NH5A 2E0HA 2NY9X 2NY8X 1BMRA 1ZYWA 1FH3A 1MR4A 1ICAA 1ZUTA 1I6GA 1PE4A 1VNBA 2B68A 1GPTA 1BK8A 1LQIA 1PTXA 1SEGA 1BRZA 2ATBA 1WMTA 1WWNA 1N4NA 1ZVGA 2E3GA 1BCGA 1NRAA 1T0ZA 5CY0A 1T7BA 3E7RL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JZB A;  1JKZ A;  1ZFU A;  2N2R A;  1PX9 A;  3E7U X;  1B7D A;  1ZU3 A;  2YEO A;  1TI5 A;  2LT8 A;  4HHF A;  1T1T A;  2KBJ A;  2N2Q A;  1I2V A;  1P00 A;  1C55 A;  2KJA A;  2I61 A;  1LQQ A;  2N66 A;  4AB0 A;  2KBH A;  2KBK A;  2YC1 C;  2BRZ A;  2MZ0 A;  2KYQ A;  4HE7 A;  1LQH A;  1DQ7 A;  1NE5 A;  1B3C A;  1NPI A;  1VNA A;  4AEI A;  1T7A A;  1ZVE A;  4KYP A;  1OZZ A;  4V1D C;  2YBR C;  1I6F A;  1P0A A;  2KGQ A;  1T7E A;  1ZYV A;  2M8B B;  2LR3 A;  2LJ7 A;  1SN4 A;  2LKB A;  1KV0 A;  1L4V A;  1MYN A;  2LY5 A;  2A7T A;  2GL1 A;  2KPY A;  4CQK A;  1AHO A;  4UJ0 A;  2KSK A;  1SN1 A;  2N69 A;  1C56 A;  2SN3 A;  2LI7 A;  1CN2 A;  2E3F A;  1WT7 A;  1CHZ A;  4AAZ A;  1DJT A;  5KK4 A;  1SNB A;  2B3C A;  1JXC A;  1AYJ A;  1NRB A;  2LY6 A;  1I2U A;  1GPS A;  2LJM A;  1OMY A;  1JZA A;  2ASC A;  3PSM A;  1NH5 A;  2E0H A;  2NY9 X;  2NY8 X;  1BMR A;  1ZYW A;  1FH3 A;  1MR4 A;  1ICA A;  1ZUT A;  1I6G A;  1PE4 A;  1VNB A;  2B68 A;  1GPT A;  1BK8 A;  1LQI A;  1PTX A;  1SEG A;  1BRZ A;  2ATB A;  1WMT A;  1WWN A;  1N4N A;  1ZVG A;  2E3G A;  1BCG A;  1NRA A;  1T0Z A;  5CY0 A;  1T7B A;  3E7R L; 
#chains in the Genus database with same CATH topology
 2QW9 A;  1JZB A;  3BK3 C;  5AQM A;  5AQT A;  1JKZ A;  2E8A A;  3FZK A;  2GMO A;  1ZFU A;  2N2R A;  1PX9 A;  5F1X A;  3E7U X;  1B7D A;  4H5N A;  5AQR A;  3KOW A;  1ZU3 A;  2YEO A;  1TI5 A;  1YUW A;  2LT8 A;  4HHF A;  1T1T A;  2KBJ A;  2N2Q A;  1HPM A;  2QWP A;  2YIP A;  1I2V A;  1P00 A;  1C55 A;  5FPM A;  1NGI A;  2YIL A;  5EY4 A;  2KJA A;  5AQS A;  2I61 A;  1LQQ A;  2N66 A;  4AB0 A;  2KBH A;  2KBK A;  2VY6 A;  2YC1 C;  1ATS A;  2BRZ A;  2MZ0 A;  2QWN A;  3D2E B;  5AQH A;  5EVZ A;  2KYQ A;  2QWO A;  4HE7 A;  1LQH A;  5AQX A;  3L4I A;  1DQ7 A;  5FPE A;  5FPD A;  1NE5 A;  2QWR A;  5AQF A;  1XRS B;  3D2E A;  3QML A;  2G2K A;  3FZF A;  5BPN A;  5AQQ A;  4UAE F;  1B3C A;  1NPI A;  1VNA A;  1BUP A;  3KVG A;  3LDL A;  4AEI A;  1T7A A;  1ZVE A;  4UAF E;  2LN8 A;  4KYP A;  2JDQ D;  5F0X A;  1KAZ A;  1OZZ A;  3QFP A;  2BUP A;  2YBR C;  3C7N A;  1I6F A;  4UAD E;  1P0A A;  2KGQ A;  4V1D C;  5BPM A;  1T7E A;  3ATV A;  5EXW A;  4H5W A;  1ZYV A;  1NGA A;  1QQO A;  2LR3 A;  2M8B B;  3LDP A;  5AQJ A;  5FPN A;  2LJ7 A;  1POI A;  1SN4 A;  2LKB A;  1KV0 A;  1L4V A;  1NGC A;  3L6Q A;  1KAY A;  1NGH A;  2MBK A;  1DKG D;  1MYN A;  3A8Y A;  4FL9 A;  5AQG A;  2LY5 A;  2A7T A;  3HSC A;  2GL1 A;  2KPY A;  4CQK A;  4IO8 A;  5BN8 A;  1AHO A;  4UJ0 A;  2KSK A;  3KC6 A;  5AQN A;  5AQZ A;  2QWM A;  1SN1 A;  3R2V A;  3CW4 A;  3KOY A;  2N69 A;  1BA1 A;  3QFU A;  2YIO A;  4H5T A;  3GL1 A;  1C56 A;  3JXU A;  2SN3 A;  1KAX A;  1NGE A;  2LI7 A;  3I33 A;  1UGL A;  2E3F A;  2MN5 A;  1CN2 A;  1WT7 A;  3KP1 A;  1CHZ A;  3C7N B;  4AAZ A;  1DJT A;  5KK4 A;  1SNB A;  2B3C A;  1JXC A;  5F2R A;  1HJO A;  1AYJ A;  1NRB A;  5AQP A;  2LY6 A;  5AQW A;  4H5R A;  2QXL A;  3D2F A;  1I2U A;  1GPS A;  1BA0 A;  2D56 A;  3LDN A;  3KHW A;  2E88 A;  2LJM A;  3KOZ A;  1OMY A;  1JZA A;  2ASC A;  2E2F A;  3PSM A;  1NH5 A;  3IUC A;  2E0H A;  2NY9 X;  2NY8 X;  3CQX A;  3KP0 A;  1BMR A;  1ZYW A;  1NGB A;  4FSV A;  1FH3 A;  1HX1 A;  1MR4 A;  3AY9 A;  5EX5 A;  3FZM A;  5AQL A;  2QWQ A;  1ICA A;  5AR0 A;  1QQM A;  5BN9 A;  1ZUT A;  2KHO A;  1I6G A;  1S3X A;  4HWI A;  3GDQ A;  1PE4 A;  1VNB A;  2V7Z A;  2B68 A;  3D2F B;  3ATU A;  3LDO A;  1K8B A;  3M3Z A;  3FZL A;  4KBO A;  5BPL A;  1GPT A;  3FE1 A;  3L56 A;  4H5V A;  5AQI A;  5AQK A;  1BK8 A;  1ATR A;  1LQI A;  5AQO A;  4GNI A;  1NGJ A;  1PTX A;  3LDQ A;  2QWL A;  5AQY A;  1NGF A;  1NGD A;  1SEG A;  5AQV A;  3GKU A;  3KOX A;  1BRZ A;  2ATB A;  1WMT A;  1WWN A;  5AQU A;  1QQN A;  1N4N A;  3QI7 A;  3SF4 D;  1NGG A;  1ZVG A;  1BCG A;  1NRA A;  2E3G A;  1T0Z A;  5CY0 A;  3FZH A;  1T7B A;  3E7R L;  2K35 A; 
#chains in the Genus database with same CATH homology
 1JZB A;  1JKZ A;  1ZFU A;  2N2R A;  1PX9 A;  3E7U X;  1B7D A;  1ZU3 A;  2YEO A;  1TI5 A;  2LT8 A;  4HHF A;  1T1T A;  2KBJ A;  2N2Q A;  1I2V A;  1P00 A;  1C55 A;  2KJA A;  2I61 A;  1LQQ A;  2N66 A;  4AB0 A;  2KBH A;  2KBK A;  2YC1 C;  2BRZ A;  2MZ0 A;  2KYQ A;  4HE7 A;  1LQH A;  1DQ7 A;  1NE5 A;  1B3C A;  1NPI A;  1VNA A;  4AEI A;  1T7A A;  1ZVE A;  4KYP A;  1OZZ A;  4V1D C;  2YBR C;  1I6F A;  1P0A A;  2KGQ A;  1T7E A;  1ZYV A;  2M8B B;  2LR3 A;  2LJ7 A;  1SN4 A;  2LKB A;  1KV0 A;  1L4V A;  1MYN A;  2LY5 A;  2A7T A;  2GL1 A;  2KPY A;  4CQK A;  1AHO A;  4UJ0 A;  2KSK A;  1SN1 A;  2N69 A;  1C56 A;  2SN3 A;  2LI7 A;  1CN2 A;  2E3F A;  1WT7 A;  1CHZ A;  4AAZ A;  1DJT A;  5KK4 A;  1SNB A;  2B3C A;  1JXC A;  1AYJ A;  1NRB A;  2LY6 A;  1I2U A;  1GPS A;  2LJM A;  1OMY A;  1JZA A;  2ASC A;  3PSM A;  1NH5 A;  2E0H A;  2NY9 X;  2NY8 X;  1BMR A;  1ZYW A;  1FH3 A;  1MR4 A;  1ICA A;  1ZUT A;  1I6G A;  1PE4 A;  1VNB A;  2B68 A;  1GPT A;  1BK8 A;  1LQI A;  1PTX A;  1SEG A;  1BRZ A;  2ATB A;  1WMT A;  1WWN A;  1N4N A;  1ZVG A;  2E3G A;  1BCG A;  1NRA A;  1T0Z A;  5CY0 A;  1T7B A;  3E7R L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...