1LQHA

Insecticidal alpha scorpion toxin isolated from the venom of scorpion leiurus quinquestriatus hebraeus, nmr, minimized average structure
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
MVRDAYIAKNYNCVYECFRDAYCNELCTKNGASSGYCQWAGKYGNACWCYALPDNVPIRVPGKCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INSECT TOXIN ALPHA
publication title Solution structures of a highly insecticidal recombinant scorpion alpha-toxin and a mutant with increased activity.
pubmed doi rcsb
source organism Leiurus quinquestriatus hebraeus
molecule tags Neurotoxin
total genus 11
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 1996-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1lqhA00
1BMRA 2B3CA 1TI5A 2LJ7A 1ZUTA 2YEOA 2KYQA 2M8BB 2KJAA 1ZYVA 3PSMA 4CQKA 1GPSA 3E7RL 1I2VA 1WWNA 1I2UA 2BRZA 1I6FA 1AHOA 2LT8A 2I61A 1T1TA 1C55A 4KYPA 1SN1A 1ICAA 1PX9A 2N2RA 1CN2A 1LQHA 1JZAA 2N66A 1T0ZA 1ZVEA 1NH5A 1ZU3A 1OZZA 1B3CA 1C56A 2GL1A 1BRZA 2LR3A 1PE4A 1JZBA 2NY9X 1P00A 1WT7A 2N2QA 2LY5A 2KBKA 2KGQA 5CY0A 1NRAA 4HE7A 1T7BA 1BCGA 1DJTA 2LI7A 3E7UX 2MZ0A 1NPIA 1N4NA 2SN3A 2NY8X 2KBHA 1NE5A 2LKBA 1VNAA 1P0AA 1JXCA 1SN4A 2A7TA 2B68A 1AYJA 1JKZA 1L4VA 2E3GA 1WMTA 2KBJA 2ATBA 1CHZA 4AAZA 2YC1C 2E0HA 2LJMA 1NRBA 1ZVGA 1SNBA 1T7AA 1BK8A 1SEGA 2N69A 1PTXA 4AB0A 4AEIA 4V1DC 2E3FA 2LY6A 1ZYWA 1DQ7A 4UJ0A 1KV0A 1MR4A 1VNBA 5KK4A 2KPYA 1MYNA 2KSKA 1GPTA 1OMYA 1B7DA 1ZFUA 2ASCA 2YBRC 1FH3A 1LQQA 1LQIA 1T7EA 4HHFA 1I6GA
chains in the Genus database with same CATH superfamily
3KP1A 5AQKA 1BMRA 2V7ZA 2B3CA 1TI5A 2LJ7A 1K8BA 2D56A 3BK3C 1KAZA 3KHWA 5AR0A 1ZUTA 2YEOA 4FSVA 2KYQA 2M8BB 2KJAA 1ZYVA 1QQMA 1BA1A 3FZHA 3PSMA 2QWOA 4KBOA 3E7RL 5F0XA 5AQYA 1GPSA 3LDOA 2E8AA 1I2VA 1WWNA 5BPMA 1NGBA 1I6FA 2BRZA 1I2UA 1AHOA 1UGLA 3I33A 5BPLA 1YUWA 1S3XA 2I61A 2LT8A 1T1TA 2QWRA 3FZMA 5AQSA 1C55A 4H5VA 4KYPA 3IUCA 5AQXA 3L6QA 1SN1A 2QWLA 3A8YA 4H5RA 4UADE 1ICAA 1PX9A 2N2RA 3QFUA 4UAFE 3LDPA 1LQHA 1CN2A 1JZAA 4GNIA 4IO8A 1BUPA 2N66A 1T0ZA 1ZVEA 1NGIA 1NH5A 3C7NA 3GL1A 3HSCA 3FZLA 3JXUA 1ZU3A 1OZZA 3M3ZA 5AQNA 1B3CA 1C56A 2GL1A 3KP0A 5AQJA 1BRZA 1NGEA 4UAEF 5EVZA 5FPNA 2LR3A 1PE4A 3KC6A 2QWPA 3SF4D 3KVGA 1JZBA 4H5WA 1ATSA 2NY9X 1QQOA 4HWIA 1P00A 1HJOA 1WT7A 2N2QA 3AY9A 5F1XA 2LY5A 2KBKA 2YIOA 2KGQA 5CY0A 1NRAA 3QI7A 4HE7A 3C7NB 5BPNA 5FPMA 5AQZA 1T7BA 1FH3A 5AQFA 5AQWA 2KHOA 1BCGA 1DJTA 2LI7A 2QW9A 2MZ0A 1NPIA 1NGFA 3E7UX 1XRSB 1NGGA 2MN5A 3KOXA 5AQHA 1N4NA 2G2KA 2SN3A 5AQQA 1HX1A 5FPEA 2NY8X 3ATVA 3QFPA 1KAXA 3QMLA 2KBHA 2MBKA 1NE5A 5EXWA 1BA0A 2LKBA 1VNAA 1P0AA 3ATUA 3LDLA 3GDQA 5AQTA 3FZFA 1JXCA 1HPMA 1SN4A 2QWQA 2A7TA 3KOYA 2B68A 3CW4A 1AYJA 2E2FA 1JKZA 2GMOA 1L4VA 5AQVA 2E3GA 1WMTA 2KBJA 2ATBA 1CHZA 2YIPA 5EY4A 3LDQA 4H5TA 3KOWA 3R2VA 3L4IA 5AQLA 1NGDA 3GKUA 5AQMA 2YC1C 4AAZA 4CQKA 2E0HA 2LJMA 1NRBA 2E88A 1ZVGA 1SNBA 1POIA 1T7AA 2BUPA 2QXLA 4H5NA 5AQUA 1SEGA 2N69A 1BK8A 1PTXA 4AB0A 1DKGD 2QWMA 4AEIA 4V1DC 2K35A 3L56A 5BN9A 2E3FA 5AQIA 2LY6A 3D2FA 1NGJA 1ATRA 1ZYWA 1NGCA 3D2EA 3KOZA 1DQ7A 2QWNA 3FE1A 4UJ0A 3LDNA 1KV0A 1MR4A 1VNBA 5KK4A 2KPYA 1MYNA 2KSKA 1GPTA 1OMYA 4FL9A 5AQRA 3CQXA 1B7DA 5AQGA 5EX5A 1NGHA 1ZFUA 1KAYA 2ASCA 2JDQD 2YBRC 5F2RA 1LQQA 2LN8A 1NGAA 2YILA 1LQIA 2VY6A 3FZKA 1QQNA 1T7EA 4HHFA 5AQPA 5BN8A 5FPDA 1I6GA 3D2FB 3D2EB 5AQOA
chains in the Genus database with same CATH topology
1BMRA 2B3CA 1TI5A 2LJ7A 1ZUTA 2YEOA 2KYQA 2M8BB 2KJAA 1ZYVA 3PSMA 4CQKA 1GPSA 3E7RL 1I2VA 1WWNA 1I2UA 2BRZA 1I6FA 1AHOA 2LT8A 2I61A 1T1TA 1C55A 4KYPA 1SN1A 1ICAA 1PX9A 2N2RA 1CN2A 1LQHA 1JZAA 2N66A 1T0ZA 1ZVEA 1NH5A 1ZU3A 1OZZA 1B3CA 1C56A 2GL1A 1BRZA 2LR3A 1PE4A 1JZBA 2NY9X 1P00A 1WT7A 2N2QA 2LY5A 2KBKA 2KGQA 5CY0A 1NRAA 4HE7A 1T7BA 1BCGA 1DJTA 2LI7A 3E7UX 2MZ0A 1NPIA 1N4NA 2SN3A 2NY8X 2KBHA 1NE5A 2LKBA 1VNAA 1P0AA 1JXCA 1SN4A 2A7TA 2B68A 1AYJA 1JKZA 1L4VA 2E3GA 1WMTA 2KBJA 2ATBA 1CHZA 4AAZA 2YC1C 2E0HA 2LJMA 1NRBA 1ZVGA 1SNBA 1T7AA 1BK8A 1SEGA 2N69A 1PTXA 4AB0A 4AEIA 4V1DC 2E3FA 2LY6A 1ZYWA 1DQ7A 4UJ0A 1KV0A 1MR4A 1VNBA 5KK4A 2KPYA 1MYNA 2KSKA 1GPTA 1OMYA 1B7DA 1ZFUA 2ASCA 2YBRC 1FH3A 1LQQA 1LQIA 1T7EA 4HHFA 1I6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BMR A;  2B3C A;  1TI5 A;  2LJ7 A;  1ZUT A;  2YEO A;  2KYQ A;  2M8B B;  2KJA A;  1ZYV A;  3PSM A;  4CQK A;  1GPS A;  3E7R L;  1I2V A;  1WWN A;  1I2U A;  2BRZ A;  1I6F A;  1AHO A;  2LT8 A;  2I61 A;  1T1T A;  1C55 A;  4KYP A;  1SN1 A;  1ICA A;  1PX9 A;  2N2R A;  1CN2 A;  1LQH A;  1JZA A;  2N66 A;  1T0Z A;  1ZVE A;  1NH5 A;  1ZU3 A;  1OZZ A;  1B3C A;  1C56 A;  2GL1 A;  1BRZ A;  2LR3 A;  1PE4 A;  1JZB A;  2NY9 X;  1P00 A;  1WT7 A;  2N2Q A;  2LY5 A;  2KBK A;  2KGQ A;  5CY0 A;  1NRA A;  4HE7 A;  1T7B A;  1BCG A;  1DJT A;  2LI7 A;  3E7U X;  2MZ0 A;  1NPI A;  1N4N A;  2SN3 A;  2NY8 X;  2KBH A;  1NE5 A;  2LKB A;  1VNA A;  1P0A A;  1JXC A;  1SN4 A;  2A7T A;  2B68 A;  1AYJ A;  1JKZ A;  1L4V A;  2E3G A;  1WMT A;  2KBJ A;  2ATB A;  1CHZ A;  4AAZ A;  2YC1 C;  2E0H A;  2LJM A;  1NRB A;  1ZVG A;  1SNB A;  1T7A A;  1BK8 A;  1SEG A;  2N69 A;  1PTX A;  4AB0 A;  4AEI A;  4V1D C;  2E3F A;  2LY6 A;  1ZYW A;  1DQ7 A;  4UJ0 A;  1KV0 A;  1MR4 A;  1VNB A;  5KK4 A;  2KPY A;  1MYN A;  2KSK A;  1GPT A;  1OMY A;  1B7D A;  1ZFU A;  2ASC A;  2YBR C;  1FH3 A;  1LQQ A;  1LQI A;  1T7E A;  4HHF A;  1I6G A; 
#chains in the Genus database with same CATH topology
 3KP1 A;  5AQK A;  1BMR A;  2V7Z A;  2B3C A;  1TI5 A;  2LJ7 A;  1K8B A;  2D56 A;  3BK3 C;  1KAZ A;  3KHW A;  5AR0 A;  1ZUT A;  2YEO A;  4FSV A;  2KYQ A;  2M8B B;  2KJA A;  1ZYV A;  1QQM A;  1BA1 A;  3FZH A;  3PSM A;  2QWO A;  4KBO A;  3E7R L;  5F0X A;  5AQY A;  1GPS A;  3LDO A;  2E8A A;  1I2V A;  1WWN A;  5BPM A;  1NGB A;  1I6F A;  2BRZ A;  1I2U A;  1AHO A;  1UGL A;  3I33 A;  5BPL A;  1YUW A;  1S3X A;  2I61 A;  2LT8 A;  1T1T A;  2QWR A;  3FZM A;  5AQS A;  1C55 A;  4H5V A;  4KYP A;  3IUC A;  5AQX A;  3L6Q A;  1SN1 A;  2QWL A;  3A8Y A;  4H5R A;  4UAD E;  1ICA A;  1PX9 A;  2N2R A;  3QFU A;  4UAF E;  3LDP A;  1LQH A;  1CN2 A;  1JZA A;  4GNI A;  4IO8 A;  1BUP A;  2N66 A;  1T0Z A;  1ZVE A;  1NGI A;  1NH5 A;  3C7N A;  3GL1 A;  3HSC A;  3FZL A;  3JXU A;  1ZU3 A;  1OZZ A;  3M3Z A;  5AQN A;  1B3C A;  1C56 A;  2GL1 A;  3KP0 A;  5AQJ A;  1BRZ A;  1NGE A;  4UAE F;  5EVZ A;  5FPN A;  2LR3 A;  1PE4 A;  3KC6 A;  2QWP A;  3SF4 D;  3KVG A;  1JZB A;  4H5W A;  1ATS A;  2NY9 X;  1QQO A;  4HWI A;  1P00 A;  1HJO A;  1WT7 A;  2N2Q A;  3AY9 A;  5F1X A;  2LY5 A;  2KBK A;  2YIO A;  2KGQ A;  5CY0 A;  1NRA A;  3QI7 A;  4HE7 A;  3C7N B;  5BPN A;  5FPM A;  5AQZ A;  1T7B A;  1FH3 A;  5AQF A;  5AQW A;  2KHO A;  1BCG A;  1DJT A;  2LI7 A;  2QW9 A;  2MZ0 A;  1NPI A;  1NGF A;  3E7U X;  1XRS B;  1NGG A;  2MN5 A;  3KOX A;  5AQH A;  1N4N A;  2G2K A;  2SN3 A;  5AQQ A;  1HX1 A;  5FPE A;  2NY8 X;  3ATV A;  3QFP A;  1KAX A;  3QML A;  2KBH A;  2MBK A;  1NE5 A;  5EXW A;  1BA0 A;  2LKB A;  1VNA A;  1P0A A;  3ATU A;  3LDL A;  3GDQ A;  5AQT A;  3FZF A;  1JXC A;  1HPM A;  1SN4 A;  2QWQ A;  2A7T A;  3KOY A;  2B68 A;  3CW4 A;  1AYJ A;  2E2F A;  1JKZ A;  2GMO A;  1L4V A;  5AQV A;  2E3G A;  1WMT A;  2KBJ A;  2ATB A;  1CHZ A;  2YIP A;  5EY4 A;  3LDQ A;  4H5T A;  3KOW A;  3R2V A;  3L4I A;  5AQL A;  1NGD A;  3GKU A;  5AQM A;  2YC1 C;  4AAZ A;  4CQK A;  2E0H A;  2LJM A;  1NRB A;  2E88 A;  1ZVG A;  1SNB A;  1POI A;  1T7A A;  2BUP A;  2QXL A;  4H5N A;  5AQU A;  1SEG A;  2N69 A;  1BK8 A;  1PTX A;  4AB0 A;  1DKG D;  2QWM A;  4AEI A;  4V1D C;  2K35 A;  3L56 A;  5BN9 A;  2E3F A;  5AQI A;  2LY6 A;  3D2F A;  1NGJ A;  1ATR A;  1ZYW A;  1NGC A;  3D2E A;  3KOZ A;  1DQ7 A;  2QWN A;  3FE1 A;  4UJ0 A;  3LDN A;  1KV0 A;  1MR4 A;  1VNB A;  5KK4 A;  2KPY A;  1MYN A;  2KSK A;  1GPT A;  1OMY A;  4FL9 A;  5AQR A;  3CQX A;  1B7D A;  5AQG A;  5EX5 A;  1NGH A;  1ZFU A;  1KAY A;  2ASC A;  2JDQ D;  2YBR C;  5F2R A;  1LQQ A;  2LN8 A;  1NGA A;  2YIL A;  1LQI A;  2VY6 A;  3FZK A;  1QQN A;  1T7E A;  4HHF A;  5AQP A;  5BN8 A;  5FPD A;  1I6G A;  3D2F B;  3D2E B;  5AQO A; 
#chains in the Genus database with same CATH homology
 1BMR A;  2B3C A;  1TI5 A;  2LJ7 A;  1ZUT A;  2YEO A;  2KYQ A;  2M8B B;  2KJA A;  1ZYV A;  3PSM A;  4CQK A;  1GPS A;  3E7R L;  1I2V A;  1WWN A;  1I2U A;  2BRZ A;  1I6F A;  1AHO A;  2LT8 A;  2I61 A;  1T1T A;  1C55 A;  4KYP A;  1SN1 A;  1ICA A;  1PX9 A;  2N2R A;  1CN2 A;  1LQH A;  1JZA A;  2N66 A;  1T0Z A;  1ZVE A;  1NH5 A;  1ZU3 A;  1OZZ A;  1B3C A;  1C56 A;  2GL1 A;  1BRZ A;  2LR3 A;  1PE4 A;  1JZB A;  2NY9 X;  1P00 A;  1WT7 A;  2N2Q A;  2LY5 A;  2KBK A;  2KGQ A;  5CY0 A;  1NRA A;  4HE7 A;  1T7B A;  1BCG A;  1DJT A;  2LI7 A;  3E7U X;  2MZ0 A;  1NPI A;  1N4N A;  2SN3 A;  2NY8 X;  2KBH A;  1NE5 A;  2LKB A;  1VNA A;  1P0A A;  1JXC A;  1SN4 A;  2A7T A;  2B68 A;  1AYJ A;  1JKZ A;  1L4V A;  2E3G A;  1WMT A;  2KBJ A;  2ATB A;  1CHZ A;  4AAZ A;  2YC1 C;  2E0H A;  2LJM A;  1NRB A;  1ZVG A;  1SNB A;  1T7A A;  1BK8 A;  1SEG A;  2N69 A;  1PTX A;  4AB0 A;  4AEI A;  4V1D C;  2E3F A;  2LY6 A;  1ZYW A;  1DQ7 A;  4UJ0 A;  1KV0 A;  1MR4 A;  1VNB A;  5KK4 A;  2KPY A;  1MYN A;  2KSK A;  1GPT A;  1OMY A;  1B7D A;  1ZFU A;  2ASC A;  2YBR C;  1FH3 A;  1LQQ A;  1LQI A;  1T7E A;  4HHF A;  1I6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...