3E7UX

X-ray crystal structure of l-plectasin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
40
structure length
40
Chain Sequence
GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords Plectasin
publication title Racemic crystallography of synthetic protein enantiomers used to determine the X-ray structure of plectasin by direct methods
pubmed doi rcsb
total genus 10
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2008-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01097 Defensin_2 Arthropod defensin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 3e7uX01
1T7EA 1KV0A 4AAZA 2YBRC 2E3FA 1OMYA 1NRAA 1DJTA 2LY6A 1GPSA 1MR4A 1JXCA 2KPYA 1T7BA 2ATBA 2KJAA 1BMRA 2ASCA 1P0AA 1PTXA 1I6GA 2B3CA 1VNAA 2KBKA 2LJ7A 4KYPA 2KYQA 1ZYVA 2KGQA 2N2QA 2LT8A 2LKBA 2LI7A 1BRZA 1JZAA 2N2RA 1PX9A 1C56A 1NE5A 1LQIA 1BCGA 1I6FA 1WMTA 4UJ0A 2E0HA 2I61A 2NY9X 1DQ7A 2NY8X 3PSMA 1TI5A 1N4NA 1B3CA 2SN3A 1FH3A 4HE7A 1ZYWA 1SN4A 1T0ZA 3E7RL 1I2UA 5KK4A 1GPTA 2BRZA 1MYNA 2N66A 1ZVGA 2LY5A 2YC1C 1PE4A 2KBHA 1SN1A 2LR3A 2KSKA 4CQKA 1CHZA 1ZVEA 2KBJA 1LQQA 1CN2A 1BK8A 1L4VA 1ZUTA 1ICAA 4AB0A 1WT7A 2GL1A 1SEGA 1NRBA 1P00A 1NH5A 1LQHA 1SNBA 1T7AA 1C55A 3E7UX 1JZBA 2YEOA 1VNBA 1T1TA 1NPIA 1ZU3A 4V1DC 4AEIA 4HHFA 1I2VA 2LJMA 2MZ0A 2A7TA 1AYJA 1WWNA 5CY0A 1AHOA 2N69A 1JKZA 2M8BB 1OZZA 1B7DA 2B68A 1ZFUA 2E3GA
chains in the Genus database with same CATH superfamily
3IUCA 1T7EA 1KV0A 1NGEA 4AAZA 5AQYA 1GPSA 2QWNA 2YBRC 1K8BA 2YIOA 2E88A 3A8YA 3LDLA 2E3FA 3KOWA 1OMYA 1NRAA 1DJTA 2LY6A 3LDNA 2V7ZA 1MR4A 3LDPA 1JXCA 3KP1A 3R2VA 4FL9A 5AQLA 5EXWA 2KPYA 1T7BA 2ATBA 4UADE 1NGGA 2KJAA 3JXUA 3KC6A 2ASCA 4GNIA 1BMRA 3QI7A 1P0AA 4H5WA 1PTXA 5EVZA 1I6GA 2QWPA 5BPMA 1NGFA 2B3CA 1VNAA 2KBKA 3D2EB 5AQFA 2LJ7A 3C7NB 4KYPA 2KYQA 1ZYVA 2KGQA 3D2EA 4H5NA 4HWIA 2N2QA 2LT8A 2QXLA 2LKBA 2LI7A 3GDQA 5AQGA 1BRZA 1JZAA 2N2RA 3I33A 1PX9A 1XRSB 3FZMA 1C56A 3ATUA 5AQTA 1POIA 1NE5A 3FZHA 2K35A 1BA1A 1LQIA 3KHWA 1KAZA 1BCGA 1ATSA 1I6FA 1NGCA 2GMOA 2YIPA 1WMTA 3FZKA 4UJ0A 1NGHA 2E0HA 2I61A 2E8AA 5FPDA 5AQWA 2NY9X 3QFPA 1DQ7A 2D56A 2NY8X 2BUPA 3PSMA 3QFUA 4H5RA 1BA0A 1TI5A 1N4NA 1B3CA 1KAXA 2E3GA 2SN3A 5AQJA 1NGDA 3CW4A 3GKUA 3LDOA 3KOYA 1FH3A 4HE7A 1ZYWA 1SN4A 1T0ZA 1NGIA 3E7RL 3KP0A 4IO8A 1I2UA 5FPEA 5KK4A 1GPTA 2BRZA 3HSCA 3LDQA 1MYNA 1HJOA 4UAEF 2N66A 5AQHA 1DKGD 1QQNA 2QW9A 1ZVGA 2LY5A 5F1XA 5F2RA 2YC1C 1QQMA 2QWOA 4UAFE 3QMLA 5BN8A 1PE4A 2KBHA 5AQSA 5BN9A 2QWRA 1SN1A 5BPLA 5AQUA 5AQMA 2LR3A 3AY9A 3KOXA 5AQXA 2E2FA 2KSKA 4CQKA 1CHZA 1ZVEA 2KBJA 1LQQA 2LN8A 3CQXA 3FZFA 2JDQD 3ATVA 5AQOA 1BK8A 1CN2A 1L4VA 1ZUTA 4FSVA 1ATRA 2MBKA 4H5VA 5AQRA 1YUWA 1ICAA 4AB0A 3SF4D 1WT7A 2GL1A 5AQQA 5BPNA 1BUPA 1KAYA 1SEGA 2QWMA 1NRBA 2YILA 5FPNA 5AQNA 5AQPA 1S3XA 3KOZA 1QQOA 3M3ZA 1P00A 3GL1A 2QWQA 5F0XA 4KBOA 1NH5A 1LQHA 1SNBA 2QWLA 1T7AA 1HPMA 1HX1A 5EX5A 1C55A 2VY6A 3E7UX 1JZBA 3FE1A 2YEOA 1NGBA 2G2KA 1VNBA 4H5TA 1T1TA 1NPIA 1ZU3A 2MN5A 3L56A 4V1DC 5AQIA 1NGJA 5AQKA 4AEIA 4HHFA 3FZLA 1I2VA 3BK3C 5AR0A 2LJMA 1NGAA 2MZ0A 5AQVA 2A7TA 1AYJA 5EY4A 1WWNA 3C7NA 5CY0A 1AHOA 2N69A 3KVGA 1JKZA 3D2FB 5AQZA 2M8BB 1OZZA 1B7DA 3L4IA 2B68A 5FPMA 3L6QA 1ZFUA 2KHOA 3D2FA 1UGLA
chains in the Genus database with same CATH topology
1T7EA 1KV0A 4AAZA 2YBRC 2E3FA 1OMYA 1NRAA 1DJTA 2LY6A 1GPSA 1MR4A 1JXCA 2KPYA 1T7BA 2ATBA 2KJAA 1BMRA 2ASCA 1P0AA 1PTXA 1I6GA 2B3CA 1VNAA 2KBKA 2LJ7A 4KYPA 2KYQA 1ZYVA 2KGQA 2N2QA 2LT8A 2LKBA 2LI7A 1BRZA 1JZAA 2N2RA 1PX9A 1C56A 1NE5A 1LQIA 1BCGA 1I6FA 1WMTA 4UJ0A 2E0HA 2I61A 2NY9X 1DQ7A 2NY8X 3PSMA 1TI5A 1N4NA 1B3CA 2SN3A 1FH3A 4HE7A 1ZYWA 1SN4A 1T0ZA 3E7RL 1I2UA 5KK4A 1GPTA 2BRZA 1MYNA 2N66A 1ZVGA 2LY5A 2YC1C 1PE4A 2KBHA 1SN1A 2LR3A 2KSKA 4CQKA 1CHZA 1ZVEA 2KBJA 1LQQA 1CN2A 1BK8A 1L4VA 1ZUTA 1ICAA 4AB0A 1WT7A 2GL1A 1SEGA 1NRBA 1P00A 1NH5A 1LQHA 1SNBA 1T7AA 1C55A 3E7UX 1JZBA 2YEOA 1VNBA 1T1TA 1NPIA 1ZU3A 4V1DC 4AEIA 4HHFA 1I2VA 2LJMA 2MZ0A 2A7TA 1AYJA 1WWNA 5CY0A 1AHOA 2N69A 1JKZA 2M8BB 1OZZA 1B7DA 2B68A 1ZFUA 2E3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T7E A;  1KV0 A;  4AAZ A;  2YBR C;  2E3F A;  1OMY A;  1NRA A;  1DJT A;  2LY6 A;  1GPS A;  1MR4 A;  1JXC A;  2KPY A;  1T7B A;  2ATB A;  2KJA A;  1BMR A;  2ASC A;  1P0A A;  1PTX A;  1I6G A;  2B3C A;  1VNA A;  2KBK A;  2LJ7 A;  4KYP A;  2KYQ A;  1ZYV A;  2KGQ A;  2N2Q A;  2LT8 A;  2LKB A;  2LI7 A;  1BRZ A;  1JZA A;  2N2R A;  1PX9 A;  1C56 A;  1NE5 A;  1LQI A;  1BCG A;  1I6F A;  1WMT A;  4UJ0 A;  2E0H A;  2I61 A;  2NY9 X;  1DQ7 A;  2NY8 X;  3PSM A;  1TI5 A;  1N4N A;  1B3C A;  2SN3 A;  1FH3 A;  4HE7 A;  1ZYW A;  1SN4 A;  1T0Z A;  3E7R L;  1I2U A;  5KK4 A;  1GPT A;  2BRZ A;  1MYN A;  2N66 A;  1ZVG A;  2LY5 A;  2YC1 C;  1PE4 A;  2KBH A;  1SN1 A;  2LR3 A;  2KSK A;  4CQK A;  1CHZ A;  1ZVE A;  2KBJ A;  1LQQ A;  1CN2 A;  1BK8 A;  1L4V A;  1ZUT A;  1ICA A;  4AB0 A;  1WT7 A;  2GL1 A;  1SEG A;  1NRB A;  1P00 A;  1NH5 A;  1LQH A;  1SNB A;  1T7A A;  1C55 A;  3E7U X;  1JZB A;  2YEO A;  1VNB A;  1T1T A;  1NPI A;  1ZU3 A;  4V1D C;  4AEI A;  4HHF A;  1I2V A;  2LJM A;  2MZ0 A;  2A7T A;  1AYJ A;  1WWN A;  5CY0 A;  1AHO A;  2N69 A;  1JKZ A;  2M8B B;  1OZZ A;  1B7D A;  2B68 A;  1ZFU A;  2E3G A; 
#chains in the Genus database with same CATH topology
 3IUC A;  1T7E A;  1KV0 A;  1NGE A;  4AAZ A;  5AQY A;  1GPS A;  2QWN A;  2YBR C;  1K8B A;  2YIO A;  2E88 A;  3A8Y A;  3LDL A;  2E3F A;  3KOW A;  1OMY A;  1NRA A;  1DJT A;  2LY6 A;  3LDN A;  2V7Z A;  1MR4 A;  3LDP A;  1JXC A;  3KP1 A;  3R2V A;  4FL9 A;  5AQL A;  5EXW A;  2KPY A;  1T7B A;  2ATB A;  4UAD E;  1NGG A;  2KJA A;  3JXU A;  3KC6 A;  2ASC A;  4GNI A;  1BMR A;  3QI7 A;  1P0A A;  4H5W A;  1PTX A;  5EVZ A;  1I6G A;  2QWP A;  5BPM A;  1NGF A;  2B3C A;  1VNA A;  2KBK A;  3D2E B;  5AQF A;  2LJ7 A;  3C7N B;  4KYP A;  2KYQ A;  1ZYV A;  2KGQ A;  3D2E A;  4H5N A;  4HWI A;  2N2Q A;  2LT8 A;  2QXL A;  2LKB A;  2LI7 A;  3GDQ A;  5AQG A;  1BRZ A;  1JZA A;  2N2R A;  3I33 A;  1PX9 A;  1XRS B;  3FZM A;  1C56 A;  3ATU A;  5AQT A;  1POI A;  1NE5 A;  3FZH A;  2K35 A;  1BA1 A;  1LQI A;  3KHW A;  1KAZ A;  1BCG A;  1ATS A;  1I6F A;  1NGC A;  2GMO A;  2YIP A;  1WMT A;  3FZK A;  4UJ0 A;  1NGH A;  2E0H A;  2I61 A;  2E8A A;  5FPD A;  5AQW A;  2NY9 X;  3QFP A;  1DQ7 A;  2D56 A;  2NY8 X;  2BUP A;  3PSM A;  3QFU A;  4H5R A;  1BA0 A;  1TI5 A;  1N4N A;  1B3C A;  1KAX A;  2E3G A;  2SN3 A;  5AQJ A;  1NGD A;  3CW4 A;  3GKU A;  3LDO A;  3KOY A;  1FH3 A;  4HE7 A;  1ZYW A;  1SN4 A;  1T0Z A;  1NGI A;  3E7R L;  3KP0 A;  4IO8 A;  1I2U A;  5FPE A;  5KK4 A;  1GPT A;  2BRZ A;  3HSC A;  3LDQ A;  1MYN A;  1HJO A;  4UAE F;  2N66 A;  5AQH A;  1DKG D;  1QQN A;  2QW9 A;  1ZVG A;  2LY5 A;  5F1X A;  5F2R A;  2YC1 C;  1QQM A;  2QWO A;  4UAF E;  3QML A;  5BN8 A;  1PE4 A;  2KBH A;  5AQS A;  5BN9 A;  2QWR A;  1SN1 A;  5BPL A;  5AQU A;  5AQM A;  2LR3 A;  3AY9 A;  3KOX A;  5AQX A;  2E2F A;  2KSK A;  4CQK A;  1CHZ A;  1ZVE A;  2KBJ A;  1LQQ A;  2LN8 A;  3CQX A;  3FZF A;  2JDQ D;  3ATV A;  5AQO A;  1BK8 A;  1CN2 A;  1L4V A;  1ZUT A;  4FSV A;  1ATR A;  2MBK A;  4H5V A;  5AQR A;  1YUW A;  1ICA A;  4AB0 A;  3SF4 D;  1WT7 A;  2GL1 A;  5AQQ A;  5BPN A;  1BUP A;  1KAY A;  1SEG A;  2QWM A;  1NRB A;  2YIL A;  5FPN A;  5AQN A;  5AQP A;  1S3X A;  3KOZ A;  1QQO A;  3M3Z A;  1P00 A;  3GL1 A;  2QWQ A;  5F0X A;  4KBO A;  1NH5 A;  1LQH A;  1SNB A;  2QWL A;  1T7A A;  1HPM A;  1HX1 A;  5EX5 A;  1C55 A;  2VY6 A;  3E7U X;  1JZB A;  3FE1 A;  2YEO A;  1NGB A;  2G2K A;  1VNB A;  4H5T A;  1T1T A;  1NPI A;  1ZU3 A;  2MN5 A;  3L56 A;  4V1D C;  5AQI A;  1NGJ A;  5AQK A;  4AEI A;  4HHF A;  3FZL A;  1I2V A;  3BK3 C;  5AR0 A;  2LJM A;  1NGA A;  2MZ0 A;  5AQV A;  2A7T A;  1AYJ A;  5EY4 A;  1WWN A;  3C7N A;  5CY0 A;  1AHO A;  2N69 A;  3KVG A;  1JKZ A;  3D2F B;  5AQZ A;  2M8B B;  1OZZ A;  1B7D A;  3L4I A;  2B68 A;  5FPM A;  3L6Q A;  1ZFU A;  2KHO A;  3D2F A;  1UGL A; 
#chains in the Genus database with same CATH homology
 1T7E A;  1KV0 A;  4AAZ A;  2YBR C;  2E3F A;  1OMY A;  1NRA A;  1DJT A;  2LY6 A;  1GPS A;  1MR4 A;  1JXC A;  2KPY A;  1T7B A;  2ATB A;  2KJA A;  1BMR A;  2ASC A;  1P0A A;  1PTX A;  1I6G A;  2B3C A;  1VNA A;  2KBK A;  2LJ7 A;  4KYP A;  2KYQ A;  1ZYV A;  2KGQ A;  2N2Q A;  2LT8 A;  2LKB A;  2LI7 A;  1BRZ A;  1JZA A;  2N2R A;  1PX9 A;  1C56 A;  1NE5 A;  1LQI A;  1BCG A;  1I6F A;  1WMT A;  4UJ0 A;  2E0H A;  2I61 A;  2NY9 X;  1DQ7 A;  2NY8 X;  3PSM A;  1TI5 A;  1N4N A;  1B3C A;  2SN3 A;  1FH3 A;  4HE7 A;  1ZYW A;  1SN4 A;  1T0Z A;  3E7R L;  1I2U A;  5KK4 A;  1GPT A;  2BRZ A;  1MYN A;  2N66 A;  1ZVG A;  2LY5 A;  2YC1 C;  1PE4 A;  2KBH A;  1SN1 A;  2LR3 A;  2KSK A;  4CQK A;  1CHZ A;  1ZVE A;  2KBJ A;  1LQQ A;  1CN2 A;  1BK8 A;  1L4V A;  1ZUT A;  1ICA A;  4AB0 A;  1WT7 A;  2GL1 A;  1SEG A;  1NRB A;  1P00 A;  1NH5 A;  1LQH A;  1SNB A;  1T7A A;  1C55 A;  3E7U X;  1JZB A;  2YEO A;  1VNB A;  1T1T A;  1NPI A;  1ZU3 A;  4V1D C;  4AEI A;  4HHF A;  1I2V A;  2LJM A;  2MZ0 A;  2A7T A;  1AYJ A;  1WWN A;  5CY0 A;  1AHO A;  2N69 A;  1JKZ A;  2M8B B;  1OZZ A;  1B7D A;  2B68 A;  1ZFU A;  2E3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...