3E7UX

X-ray crystal structure of l-plectasin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
40
structure length
40
Chain Sequence
GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plectasin
publication title Racemic crystallography of synthetic protein enantiomers used to determine the X-ray structure of plectasin by direct methods
pubmed doi rcsb
molecule tags Antimicrobial protein
total genus 10
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 2008-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01097 Defensin_2 Arthropod defensin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 3e7uX01
1ZU3A 2ATBA 2E3FA 1ZYVA 1TI5A 1PX9A 2N69A 1ZFUA 1AHOA 2LJ7A 2N2QA 5KK4A 1C56A 1I2VA 1N4NA 1NH5A 1VNBA 1BMRA 1CHZA 1JXCA 1PTXA 2YBRC 1NRBA 2LJMA 4AAZA 1LQQA 2LI7A 2GL1A 1NRAA 1I6FA 1MR4A 2I61A 1T7EA 1OMYA 3PSMA 1T7AA 2KYQA 1AYJA 1T1TA 1GPTA 1DJTA 1ZYWA 1PE4A 1WMTA 1BRZA 2NY9X 1CN2A 1NE5A 2KBJA 2N2RA 1ICAA 2ASCA 2B68A 2KGQA 1B3CA 1ZUTA 3E7RL 1WWNA 2M8BB 1JZBA 2NY8X 4AB0A 1C55A 2N66A 1LQHA 2MZ0A 1L4VA 4CQKA 2KBHA 1FH3A 4HE7A 1JKZA 1WT7A 2LT8A 1B7DA 1NPIA 1ZVEA 2B3CA 1LQIA 2LKBA 1KV0A 2KBKA 2YC1C 2LR3A 2KJAA 1T7BA 2LY5A 4KYPA 1JZAA 1BK8A 5CY0A 3E7UX 2KSKA 4HHFA 2SN3A 1ZVGA 2YEOA 1I2UA 1SNBA 2BRZA 2LY6A 1VNAA 1BCGA 2E0HA 1GPSA 1P0AA 4UJ0A 1P00A 1SEGA 1OZZA 1MYNA 2KPYA 1DQ7A 4V1DC 1T0ZA 4AEIA 1SN4A 2E3GA 1I6GA 1SN1A 2A7TA
chains in the Genus database with same CATH superfamily
4UADE 1ZU3A 2ATBA 2E3FA 5EY4A 5AQWA 5BPNA 3L4IA 3LDLA 1ZYVA 1TI5A 1PX9A 2N69A 1ZFUA 3ATUA 1AHOA 2LJ7A 3GL1A 3KP0A 1YUWA 2N2QA 5KK4A 1C56A 3FZHA 5BN8A 3L6QA 2QWOA 1I2VA 1N4NA 2G2KA 4FSVA 3QI7A 1NGGA 2QWRA 4IO8A 1NH5A 1VNBA 5AQQA 5AQSA 1BMRA 3FE1A 1UGLA 3C7NB 1CHZA 1JXCA 1PTXA 2JDQD 2YBRC 3SF4D 1ATSA 1NRBA 2QWPA 2LJMA 3R2VA 4AAZA 1NGJA 1LQQA 2LI7A 2QWMA 2GL1A 2YIOA 3GKUA 5AQTA 3M3ZA 1NRAA 5AQLA 3LDPA 5FPEA 3D2FB 1I6FA 1MR4A 5AQRA 5AQMA 5AQUA 3CQXA 3FZFA 3D2EB 1NGBA 2I61A 3CW4A 1NGIA 5AQHA 3BK3C 5AQPA 1T7EA 1B3CA 1OMYA 3PSMA 1T7AA 2KYQA 3ATVA 1AYJA 2QWQA 1T1TA 3KVGA 1GPTA 1DJTA 1ZYWA 2D56A 4H5WA 3KOWA 1PE4A 1WMTA 5FPNA 2NY9X 1BRZA 1CN2A 3QFPA 2QWLA 1NE5A 4FL9A 5BPMA 2KBJA 3C7NA 5AQOA 2N2RA 3QMLA 3A8YA 5AQNA 5AQIA 1NGCA 2ASCA 1NGHA 2B68A 2E2FA 2KGQA 1BA1A 3GDQA 1DKGD 3JXUA 2BUPA 3KC6A 3L56A 3I33A 2MN5A 1ZUTA 2QW9A 4GNIA 3E7RL 1WWNA 2LN8A 2M8BB 3KHWA 1JZBA 2NY8X 5F0XA 5BPLA 4AB0A 1POIA 3D2FA 5AQZA 1C55A 2N66A 1LQHA 3D2EA 2QXLA 2MZ0A 1L4VA 1KAZA 5AQYA 4CQKA 2GMOA 3AY9A 3FZLA 2KHOA 2KBHA 1NGDA 4HE7A 3FZMA 3KOZA 2K35A 1NGAA 1HPMA 2YILA 5AQJA 5EVZA 5FPDA 1JKZA 1WT7A 1HJOA 1KAYA 1ICAA 2LT8A 3IUCA 2VY6A 5BN9A 1B7DA 1NPIA 1ZVEA 2B3CA 1KAXA 4H5NA 1LQIA 1HX1A 1K8BA 4H5TA 2LKBA 1KV0A 2KBKA 1NGEA 2YC1C 1ATRA 1QQOA 2KJAA 1T7BA 2LR3A 2LY5A 3KP1A 4KYPA 1JZAA 5AQGA 5AR0A 2QWNA 3KOYA 5CY0A 1BK8A 3E7UX 1S3XA 2KSKA 4HHFA 5EXWA 5F1XA 2SN3A 2E8AA 5AQVA 1ZVGA 2MBKA 1BUPA 1SNBA 2YEOA 4UAEF 1I2UA 3FZKA 5AQFA 5FPMA 2BRZA 2LY6A 5F2RA 1QQNA 1VNAA 2E88A 3LDOA 4HWIA 3LDQA 1NGFA 4H5RA 1BCGA 2E0HA 1GPSA 1P0AA 5AQXA 1P00A 1SEGA 4UJ0A 1XRSB 1OZZA 2YIPA 1MYNA 3LDNA 2KPYA 1FH3A 1DQ7A 4V1DC 3QFUA 1T0ZA 5AQKA 4AEIA 1BA0A 3HSCA 1SN4A 4H5VA 2E3GA 3KOXA 4UAFE 1QQMA 2V7ZA 1I6GA 5EX5A 4KBOA 1SN1A 2A7TA
chains in the Genus database with same CATH topology
1ZU3A 2ATBA 2E3FA 1ZYVA 1TI5A 1PX9A 2N69A 1ZFUA 1AHOA 2LJ7A 2N2QA 5KK4A 1C56A 1I2VA 1N4NA 1NH5A 1VNBA 1BMRA 1CHZA 1JXCA 1PTXA 2YBRC 1NRBA 2LJMA 4AAZA 1LQQA 2LI7A 2GL1A 1NRAA 1I6FA 1MR4A 2I61A 1T7EA 1OMYA 3PSMA 1T7AA 2KYQA 1AYJA 1T1TA 1GPTA 1DJTA 1ZYWA 1PE4A 1WMTA 1BRZA 2NY9X 1CN2A 1NE5A 2KBJA 2N2RA 1ICAA 2ASCA 2B68A 2KGQA 1B3CA 1ZUTA 3E7RL 1WWNA 2M8BB 1JZBA 2NY8X 4AB0A 1C55A 2N66A 1LQHA 2MZ0A 1L4VA 4CQKA 2KBHA 1FH3A 4HE7A 1JKZA 1WT7A 2LT8A 1B7DA 1NPIA 1ZVEA 2B3CA 1LQIA 2LKBA 1KV0A 2KBKA 2YC1C 2LR3A 2KJAA 1T7BA 2LY5A 4KYPA 1JZAA 1BK8A 5CY0A 3E7UX 2KSKA 4HHFA 2SN3A 1ZVGA 2YEOA 1I2UA 1SNBA 2BRZA 2LY6A 1VNAA 1BCGA 2E0HA 1GPSA 1P0AA 4UJ0A 1P00A 1SEGA 1OZZA 1MYNA 2KPYA 1DQ7A 4V1DC 1T0ZA 4AEIA 1SN4A 2E3GA 1I6GA 1SN1A 2A7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZU3 A;  2ATB A;  2E3F A;  1ZYV A;  1TI5 A;  1PX9 A;  2N69 A;  1ZFU A;  1AHO A;  2LJ7 A;  2N2Q A;  5KK4 A;  1C56 A;  1I2V A;  1N4N A;  1NH5 A;  1VNB A;  1BMR A;  1CHZ A;  1JXC A;  1PTX A;  2YBR C;  1NRB A;  2LJM A;  4AAZ A;  1LQQ A;  2LI7 A;  2GL1 A;  1NRA A;  1I6F A;  1MR4 A;  2I61 A;  1T7E A;  1OMY A;  3PSM A;  1T7A A;  2KYQ A;  1AYJ A;  1T1T A;  1GPT A;  1DJT A;  1ZYW A;  1PE4 A;  1WMT A;  1BRZ A;  2NY9 X;  1CN2 A;  1NE5 A;  2KBJ A;  2N2R A;  1ICA A;  2ASC A;  2B68 A;  2KGQ A;  1B3C A;  1ZUT A;  3E7R L;  1WWN A;  2M8B B;  1JZB A;  2NY8 X;  4AB0 A;  1C55 A;  2N66 A;  1LQH A;  2MZ0 A;  1L4V A;  4CQK A;  2KBH A;  1FH3 A;  4HE7 A;  1JKZ A;  1WT7 A;  2LT8 A;  1B7D A;  1NPI A;  1ZVE A;  2B3C A;  1LQI A;  2LKB A;  1KV0 A;  2KBK A;  2YC1 C;  2LR3 A;  2KJA A;  1T7B A;  2LY5 A;  4KYP A;  1JZA A;  1BK8 A;  5CY0 A;  3E7U X;  2KSK A;  4HHF A;  2SN3 A;  1ZVG A;  2YEO A;  1I2U A;  1SNB A;  2BRZ A;  2LY6 A;  1VNA A;  1BCG A;  2E0H A;  1GPS A;  1P0A A;  4UJ0 A;  1P00 A;  1SEG A;  1OZZ A;  1MYN A;  2KPY A;  1DQ7 A;  4V1D C;  1T0Z A;  4AEI A;  1SN4 A;  2E3G A;  1I6G A;  1SN1 A;  2A7T A; 
#chains in the Genus database with same CATH topology
 4UAD E;  1ZU3 A;  2ATB A;  2E3F A;  5EY4 A;  5AQW A;  5BPN A;  3L4I A;  3LDL A;  1ZYV A;  1TI5 A;  1PX9 A;  2N69 A;  1ZFU A;  3ATU A;  1AHO A;  2LJ7 A;  3GL1 A;  3KP0 A;  1YUW A;  2N2Q A;  5KK4 A;  1C56 A;  3FZH A;  5BN8 A;  3L6Q A;  2QWO A;  1I2V A;  1N4N A;  2G2K A;  4FSV A;  3QI7 A;  1NGG A;  2QWR A;  4IO8 A;  1NH5 A;  1VNB A;  5AQQ A;  5AQS A;  1BMR A;  3FE1 A;  1UGL A;  3C7N B;  1CHZ A;  1JXC A;  1PTX A;  2JDQ D;  2YBR C;  3SF4 D;  1ATS A;  1NRB A;  2QWP A;  2LJM A;  3R2V A;  4AAZ A;  1NGJ A;  1LQQ A;  2LI7 A;  2QWM A;  2GL1 A;  2YIO A;  3GKU A;  5AQT A;  3M3Z A;  1NRA A;  5AQL A;  3LDP A;  5FPE A;  3D2F B;  1I6F A;  1MR4 A;  5AQR A;  5AQM A;  5AQU A;  3CQX A;  3FZF A;  3D2E B;  1NGB A;  2I61 A;  3CW4 A;  1NGI A;  5AQH A;  3BK3 C;  5AQP A;  1T7E A;  1B3C A;  1OMY A;  3PSM A;  1T7A A;  2KYQ A;  3ATV A;  1AYJ A;  2QWQ A;  1T1T A;  3KVG A;  1GPT A;  1DJT A;  1ZYW A;  2D56 A;  4H5W A;  3KOW A;  1PE4 A;  1WMT A;  5FPN A;  2NY9 X;  1BRZ A;  1CN2 A;  3QFP A;  2QWL A;  1NE5 A;  4FL9 A;  5BPM A;  2KBJ A;  3C7N A;  5AQO A;  2N2R A;  3QML A;  3A8Y A;  5AQN A;  5AQI A;  1NGC A;  2ASC A;  1NGH A;  2B68 A;  2E2F A;  2KGQ A;  1BA1 A;  3GDQ A;  1DKG D;  3JXU A;  2BUP A;  3KC6 A;  3L56 A;  3I33 A;  2MN5 A;  1ZUT A;  2QW9 A;  4GNI A;  3E7R L;  1WWN A;  2LN8 A;  2M8B B;  3KHW A;  1JZB A;  2NY8 X;  5F0X A;  5BPL A;  4AB0 A;  1POI A;  3D2F A;  5AQZ A;  1C55 A;  2N66 A;  1LQH A;  3D2E A;  2QXL A;  2MZ0 A;  1L4V A;  1KAZ A;  5AQY A;  4CQK A;  2GMO A;  3AY9 A;  3FZL A;  2KHO A;  2KBH A;  1NGD A;  4HE7 A;  3FZM A;  3KOZ A;  2K35 A;  1NGA A;  1HPM A;  2YIL A;  5AQJ A;  5EVZ A;  5FPD A;  1JKZ A;  1WT7 A;  1HJO A;  1KAY A;  1ICA A;  2LT8 A;  3IUC A;  2VY6 A;  5BN9 A;  1B7D A;  1NPI A;  1ZVE A;  2B3C A;  1KAX A;  4H5N A;  1LQI A;  1HX1 A;  1K8B A;  4H5T A;  2LKB A;  1KV0 A;  2KBK A;  1NGE A;  2YC1 C;  1ATR A;  1QQO A;  2KJA A;  1T7B A;  2LR3 A;  2LY5 A;  3KP1 A;  4KYP A;  1JZA A;  5AQG A;  5AR0 A;  2QWN A;  3KOY A;  5CY0 A;  1BK8 A;  3E7U X;  1S3X A;  2KSK A;  4HHF A;  5EXW A;  5F1X A;  2SN3 A;  2E8A A;  5AQV A;  1ZVG A;  2MBK A;  1BUP A;  1SNB A;  2YEO A;  4UAE F;  1I2U A;  3FZK A;  5AQF A;  5FPM A;  2BRZ A;  2LY6 A;  5F2R A;  1QQN A;  1VNA A;  2E88 A;  3LDO A;  4HWI A;  3LDQ A;  1NGF A;  4H5R A;  1BCG A;  2E0H A;  1GPS A;  1P0A A;  5AQX A;  1P00 A;  1SEG A;  4UJ0 A;  1XRS B;  1OZZ A;  2YIP A;  1MYN A;  3LDN A;  2KPY A;  1FH3 A;  1DQ7 A;  4V1D C;  3QFU A;  1T0Z A;  5AQK A;  4AEI A;  1BA0 A;  3HSC A;  1SN4 A;  4H5V A;  2E3G A;  3KOX A;  4UAF E;  1QQM A;  2V7Z A;  1I6G A;  5EX5 A;  4KBO A;  1SN1 A;  2A7T A; 
#chains in the Genus database with same CATH homology
 1ZU3 A;  2ATB A;  2E3F A;  1ZYV A;  1TI5 A;  1PX9 A;  2N69 A;  1ZFU A;  1AHO A;  2LJ7 A;  2N2Q A;  5KK4 A;  1C56 A;  1I2V A;  1N4N A;  1NH5 A;  1VNB A;  1BMR A;  1CHZ A;  1JXC A;  1PTX A;  2YBR C;  1NRB A;  2LJM A;  4AAZ A;  1LQQ A;  2LI7 A;  2GL1 A;  1NRA A;  1I6F A;  1MR4 A;  2I61 A;  1T7E A;  1OMY A;  3PSM A;  1T7A A;  2KYQ A;  1AYJ A;  1T1T A;  1GPT A;  1DJT A;  1ZYW A;  1PE4 A;  1WMT A;  1BRZ A;  2NY9 X;  1CN2 A;  1NE5 A;  2KBJ A;  2N2R A;  1ICA A;  2ASC A;  2B68 A;  2KGQ A;  1B3C A;  1ZUT A;  3E7R L;  1WWN A;  2M8B B;  1JZB A;  2NY8 X;  4AB0 A;  1C55 A;  2N66 A;  1LQH A;  2MZ0 A;  1L4V A;  4CQK A;  2KBH A;  1FH3 A;  4HE7 A;  1JKZ A;  1WT7 A;  2LT8 A;  1B7D A;  1NPI A;  1ZVE A;  2B3C A;  1LQI A;  2LKB A;  1KV0 A;  2KBK A;  2YC1 C;  2LR3 A;  2KJA A;  1T7B A;  2LY5 A;  4KYP A;  1JZA A;  1BK8 A;  5CY0 A;  3E7U X;  2KSK A;  4HHF A;  2SN3 A;  1ZVG A;  2YEO A;  1I2U A;  1SNB A;  2BRZ A;  2LY6 A;  1VNA A;  1BCG A;  2E0H A;  1GPS A;  1P0A A;  4UJ0 A;  1P00 A;  1SEG A;  1OZZ A;  1MYN A;  2KPY A;  1DQ7 A;  4V1D C;  1T0Z A;  4AEI A;  1SN4 A;  2E3G A;  1I6G A;  1SN1 A;  2A7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...