3R2VA

Crystal structure of polymerase basic protein 2 e538-r753 from influenza a virus a/yokohama/2017/03 h3n2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
198
structure length
192
Chain Sequence
GPESVLVNTYQWIIRNWEAVKIQWSQNPAMLYNKMEFEPFQSLVPKAIRSQYSGFVRTLFQQMRDVLGTFDTTQIIKLLPFAAAPPKQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNKTTKRLTILGKDAGTLIEDGVESAVLRGFLIIGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Protein Maker: an automated system for high-throughput parallel purification.
pubmed doi rcsb
molecule keywords PB2 C-terminal subunit
molecule tags Viral protein
source organism Influenza a virus
total genus 55
structure length 192
sequence length 198
ec nomenclature
pdb deposition date 2011-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00604 Flu_PB2 Influenza RNA-dependent RNA polymerase subunit PB2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 3r2vA02
3L56A 2GMOA 4UAEF 4UADE 3KC6A 3CW4A 3R2VA 3KHWA 2VY6A 4UAFE 2JDQD
chains in the Genus database with same CATH superfamily
1BK8A 3KOZA 2A7TA 5AQOA 1BUPA 3IUCA 2E2FA 2N2RA 2KHOA 4AAZA 1KAXA 3D2EB 4V1DC 2QWMA 1NGFA 2JDQD 2KSKA 5EX5A 2N69A 2SN3A 5BPNA 1K8BA 4HWIA 1NRAA 1I6FA 1SNBA 2VY6A 3FE1A 1CHZA 1JXCA 3GL1A 5AQIA 3L56A 5F2RA 4IO8A 3GDQA 3JXUA 1P0AA 2E8AA 2YIOA 5FPEA 2QWPA 4GNIA 3I33A 5F1XA 1CN2A 1ZFUA 1T7BA 2QWQA 1NGBA 1SN1A 1DJTA 1NPIA 3LDOA 3QMLA 5AQQA 2LY6A 1JKZA 2MN5A 5AQWA 2MBKA 5BN9A 1NGCA 5EXWA 5AQTA 1BRZA 1QQMA 2E0HA 2YIPA 2LR3A 4H5NA 2YEOA 3CW4A 1ATRA 1I2VA 3FZHA 2B3CA 1ZU3A 3SF4D 1ICAA 2LN8A 1NGGA 1HX1A 5AQFA 1TI5A 2KGQA 1KAZA 2V7ZA 2B68A 2M8BB 3D2FB 2NY9X 1BMRA 4AEIA 5KK4A 5AR0A 1B7DA 1NGEA 2QWOA 2QWRA 3HSCA 1PE4A 2ATBA 2N2QA 2YILA 5AQZA 1LQHA 3A8YA 1POIA 3L6QA 2E3GA 1PTXA 2QXLA 3C7NA 3D2FA 3QFPA 3FZFA 5EVZA 5BPLA 1GPTA 4H5TA 1KV0A 1ZYVA 2LJ7A 2LJMA 1PX9A 2KPYA 3LDPA 1FH3A 5AQXA 2K35A 3LDLA 1ZYWA 5FPDA 2YC1C 1VNAA 1C56A 3ATUA 3BK3C 5AQPA 5F0XA 1LQIA 3QFUA 5AQRA 1NGDA 1NGJA 1LQQA 3E7RL 5AQJA 2KBHA 1SN4A 1BA1A 2QWLA 1BCGA 3E7UX 5AQMA 5AQGA 1JZBA 1I6GA 3FZKA 4UAFE 3CQXA 1JZAA 1N4NA 1I2UA 2KBKA 3KP0A 4FL9A 1OZZA 2KYQA 5EY4A 1VNBA 3C7NB 1AYJA 1NGIA 3KOXA 5AQHA 1HJOA 1DKGD 2QW9A 3PSMA 5AQUA 1QQNA 2KJAA 2G2KA 1GPSA 4H5RA 5CY0A 1T1TA 1BA0A 1ZVGA 5BPMA 1WWNA 1AHOA 2ASCA 4HE7A 5AQLA 1L4VA 2GMOA 3KOWA 2I61A 1UGLA 1NGHA 4H5VA 1T0ZA 1T7AA 1DQ7A 1MR4A 5AQNA 1HPMA 5FPNA 1NGAA 3KVGA 3LDQA 1XRSB 2LY5A 3LDNA 2LI7A 4UAEF 1S3XA 1WMTA 1ZVEA 2QWNA 2GL1A 2YBRC 3ATVA 3GKUA 3KC6A 4HHFA 1ATSA 3FZMA 5AQSA 2E3FA 5BN8A 4KYPA 1WT7A 2BRZA 4AB0A 1B3CA 5AQYA 5FPMA 2LKBA 3D2EA 2E88A 3L4IA 2D56A 3QI7A 3R2VA 2KBJA 3FZLA 2N66A 4CQKA 1C55A 2BUPA 1KAYA 5AQKA 3KOYA 1ZUTA 2MZ0A 4FSVA 2NY8X 4H5WA 4KBOA 1T7EA 3KHWA 1SEGA 3AY9A 4UJ0A 1NH5A 1P00A 2LT8A 3KP1A 5AQVA 4UADE 3M3ZA 1MYNA 1YUWA 1NRBA 1OMYA 1NE5A 1QQOA
chains in the Genus database with same CATH topology
5AQOA 1BUPA 3IUCA 2E2FA 2KHOA 1KAXA 3D2EB 2QWMA 1NGFA 2JDQD 5EX5A 5BPNA 4HWIA 2VY6A 3FE1A 5AQIA 3GL1A 3L56A 5F2RA 4IO8A 3GDQA 3JXUA 2E8AA 2YIOA 5FPEA 2QWPA 4GNIA 3I33A 5F1XA 2QWQA 1NGBA 5AQQA 3LDOA 3QMLA 2MN5A 5AQWA 2MBKA 5BN9A 1NGCA 5EXWA 5AQTA 1QQMA 4H5NA 2YIPA 3CW4A 1ATRA 3FZHA 3SF4D 2LN8A 1NGGA 1HX1A 5AQFA 2V7ZA 1KAZA 3D2FB 5AR0A 1NGEA 2QWOA 2QWRA 3HSCA 2YILA 5AQZA 3L6QA 5AQYA 1POIA 2QXLA 5EVZA 3C7NA 3QFPA 3D2FA 3FZFA 5BPLA 4H5TA 3LDPA 5AQXA 2K35A 3LDLA 5FPDA 3ATUA 5F0XA 5AQPA 3BK3C 3QFUA 5AQRA 1NGDA 1NGJA 5AQJA 1BA1A 2QWLA 5AQMA 5AQGA 3FZKA 4UAFE 3CQXA 4FL9A 5EY4A 3C7NB 1NGIA 5AQHA 1HJOA 1DKGD 2QW9A 5AQUA 1QQNA 4H5RA 1BA0A 5BPMA 5AQLA 2GMOA 4H5VA 1NGHA 5AQNA 1HPMA 5FPNA 1NGAA 3KVGA 3LDQA 3LDNA 4UAEF 1S3XA 2QWNA 3ATVA 3KC6A 5AQSA 1ATSA 3FZMA 5BN8A 5FPMA 3D2EA 3L4IA 2E88A 3QI7A 2D56A 3R2VA 3FZLA 2BUPA 1KAYA 5AQKA 4FSVA 4H5WA 4KBOA 3KHWA 3AY9A 5AQVA 4UADE 3M3ZA 1YUWA 3A8YA 1QQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L56 A;  2GMO A;  4UAE F;  4UAD E;  3KC6 A;  3CW4 A;  3R2V A;  3KHW A;  2VY6 A;  4UAF E;  2JDQ D; 
#chains in the Genus database with same CATH topology
 1BK8 A;  3KOZ A;  2A7T A;  5AQO A;  1BUP A;  3IUC A;  2E2F A;  2N2R A;  2KHO A;  4AAZ A;  1KAX A;  3D2E B;  4V1D C;  2QWM A;  1NGF A;  2JDQ D;  2KSK A;  5EX5 A;  2N69 A;  2SN3 A;  5BPN A;  1K8B A;  4HWI A;  1NRA A;  1I6F A;  1SNB A;  2VY6 A;  3FE1 A;  1CHZ A;  1JXC A;  3GL1 A;  5AQI A;  3L56 A;  5F2R A;  4IO8 A;  3GDQ A;  3JXU A;  1P0A A;  2E8A A;  2YIO A;  5FPE A;  2QWP A;  4GNI A;  3I33 A;  5F1X A;  1CN2 A;  1ZFU A;  1T7B A;  2QWQ A;  1NGB A;  1SN1 A;  1DJT A;  1NPI A;  3LDO A;  3QML A;  5AQQ A;  2LY6 A;  1JKZ A;  2MN5 A;  5AQW A;  2MBK A;  5BN9 A;  1NGC A;  5EXW A;  5AQT A;  1BRZ A;  1QQM A;  2E0H A;  2YIP A;  2LR3 A;  4H5N A;  2YEO A;  3CW4 A;  1ATR A;  1I2V A;  3FZH A;  2B3C A;  1ZU3 A;  3SF4 D;  1ICA A;  2LN8 A;  1NGG A;  1HX1 A;  5AQF A;  1TI5 A;  2KGQ A;  1KAZ A;  2V7Z A;  2B68 A;  2M8B B;  3D2F B;  2NY9 X;  1BMR A;  4AEI A;  5KK4 A;  5AR0 A;  1B7D A;  1NGE A;  2QWO A;  2QWR A;  3HSC A;  1PE4 A;  2ATB A;  2N2Q A;  2YIL A;  5AQZ A;  1LQH A;  3A8Y A;  1POI A;  3L6Q A;  2E3G A;  1PTX A;  2QXL A;  3C7N A;  3D2F A;  3QFP A;  3FZF A;  5EVZ A;  5BPL A;  1GPT A;  4H5T A;  1KV0 A;  1ZYV A;  2LJ7 A;  2LJM A;  1PX9 A;  2KPY A;  3LDP A;  1FH3 A;  5AQX A;  2K35 A;  3LDL A;  1ZYW A;  5FPD A;  2YC1 C;  1VNA A;  1C56 A;  3ATU A;  3BK3 C;  5AQP A;  5F0X A;  1LQI A;  3QFU A;  5AQR A;  1NGD A;  1NGJ A;  1LQQ A;  3E7R L;  5AQJ A;  2KBH A;  1SN4 A;  1BA1 A;  2QWL A;  1BCG A;  3E7U X;  5AQM A;  5AQG A;  1JZB A;  1I6G A;  3FZK A;  4UAF E;  3CQX A;  1JZA A;  1N4N A;  1I2U A;  2KBK A;  3KP0 A;  4FL9 A;  1OZZ A;  2KYQ A;  5EY4 A;  1VNB A;  3C7N B;  1AYJ A;  1NGI A;  3KOX A;  5AQH A;  1HJO A;  1DKG D;  2QW9 A;  3PSM A;  5AQU A;  1QQN A;  2KJA A;  2G2K A;  1GPS A;  4H5R A;  5CY0 A;  1T1T A;  1BA0 A;  1ZVG A;  5BPM A;  1WWN A;  1AHO A;  2ASC A;  4HE7 A;  5AQL A;  1L4V A;  2GMO A;  3KOW A;  2I61 A;  1UGL A;  1NGH A;  4H5V A;  1T0Z A;  1T7A A;  1DQ7 A;  1MR4 A;  5AQN A;  1HPM A;  5FPN A;  1NGA A;  3KVG A;  3LDQ A;  1XRS B;  2LY5 A;  3LDN A;  2LI7 A;  4UAE F;  1S3X A;  1WMT A;  1ZVE A;  2QWN A;  2GL1 A;  2YBR C;  3ATV A;  3GKU A;  3KC6 A;  4HHF A;  1ATS A;  3FZM A;  5AQS A;  2E3F A;  5BN8 A;  4KYP A;  1WT7 A;  2BRZ A;  4AB0 A;  1B3C A;  5AQY A;  5FPM A;  2LKB A;  3D2E A;  2E88 A;  3L4I A;  2D56 A;  3QI7 A;  3R2V A;  2KBJ A;  3FZL A;  2N66 A;  4CQK A;  1C55 A;  2BUP A;  1KAY A;  5AQK A;  3KOY A;  1ZUT A;  2MZ0 A;  4FSV A;  2NY8 X;  4H5W A;  4KBO A;  1T7E A;  3KHW A;  1SEG A;  3AY9 A;  4UJ0 A;  1NH5 A;  1P00 A;  2LT8 A;  3KP1 A;  5AQV A;  4UAD E;  3M3Z A;  1MYN A;  1YUW A;  1NRB A;  1OMY A;  1NE5 A;  1QQO A; 
#chains in the Genus database with same CATH homology
 5AQO A;  1BUP A;  3IUC A;  2E2F A;  2KHO A;  1KAX A;  3D2E B;  2QWM A;  1NGF A;  2JDQ D;  5EX5 A;  5BPN A;  4HWI A;  2VY6 A;  3FE1 A;  5AQI A;  3GL1 A;  3L56 A;  5F2R A;  4IO8 A;  3GDQ A;  3JXU A;  2E8A A;  2YIO A;  5FPE A;  2QWP A;  4GNI A;  3I33 A;  5F1X A;  2QWQ A;  1NGB A;  5AQQ A;  3LDO A;  3QML A;  2MN5 A;  5AQW A;  2MBK A;  5BN9 A;  1NGC A;  5EXW A;  5AQT A;  1QQM A;  4H5N A;  2YIP A;  3CW4 A;  1ATR A;  3FZH A;  3SF4 D;  2LN8 A;  1NGG A;  1HX1 A;  5AQF A;  2V7Z A;  1KAZ A;  3D2F B;  5AR0 A;  1NGE A;  2QWO A;  2QWR A;  3HSC A;  2YIL A;  5AQZ A;  3L6Q A;  5AQY A;  1POI A;  2QXL A;  5EVZ A;  3C7N A;  3QFP A;  3D2F A;  3FZF A;  5BPL A;  4H5T A;  3LDP A;  5AQX A;  2K35 A;  3LDL A;  5FPD A;  3ATU A;  5F0X A;  5AQP A;  3BK3 C;  3QFU A;  5AQR A;  1NGD A;  1NGJ A;  5AQJ A;  1BA1 A;  2QWL A;  5AQM A;  5AQG A;  3FZK A;  4UAF E;  3CQX A;  4FL9 A;  5EY4 A;  3C7N B;  1NGI A;  5AQH A;  1HJO A;  1DKG D;  2QW9 A;  5AQU A;  1QQN A;  4H5R A;  1BA0 A;  5BPM A;  5AQL A;  2GMO A;  4H5V A;  1NGH A;  5AQN A;  1HPM A;  5FPN A;  1NGA A;  3KVG A;  3LDQ A;  3LDN A;  4UAE F;  1S3X A;  2QWN A;  3ATV A;  3KC6 A;  5AQS A;  1ATS A;  3FZM A;  5BN8 A;  5FPM A;  3D2E A;  3L4I A;  2E88 A;  3QI7 A;  2D56 A;  3R2V A;  3FZL A;  2BUP A;  1KAY A;  5AQK A;  4FSV A;  4H5W A;  4KBO A;  3KHW A;  3AY9 A;  5AQV A;  4UAD E;  3M3Z A;  1YUW A;  3A8Y A;  1QQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...