2VY6A

Two domains from the c-terminal region of influenza a virus polymerase pb2 subunit
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
204
structure length
196
Chain Sequence
EINGPESVLVNTYQWIIRNWETVKIQWSQNPTMLYNKMEFEPFQSLVPKAIRGQYSGFVRTLFQQMRDVLGTFDTTQIIKLLPFAAAPPKQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNKTTKRLTILGKDAGTLIEVESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYMERASE BASIC PROTEIN 2
publication title Host Determinant Residue Lysine 627 Lies on the Surface of a Discrete, Folded Domain of Influenza Virus Polymerase Pb2 Subunit
pubmed doi rcsb
source organism Influenza a virus
molecule tags Transcription
total genus 58
structure length 196
sequence length 204
ec nomenclature
pdb deposition date 2008-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2vy6A02
3L56A 3KHWA 4UADE 2GMOA 2VY6A 3KC6A 4UAFE 3R2VA 2JDQD 3CW4A 4UAEF
chains in the Genus database with same CATH superfamily
1NGIA 1XRSB 1YUWA 2D56A 2K35A 2QWOA 1T7EA 3FZFA 1AHOA 5AR0A 2KHOA 3JXUA 3A8YA 2QWQA 3L4IA 1B3CA 2E3GA 1C56A 2MBKA 2N69A 2NY8X 4HWIA 2N2QA 3FE1A 2YIOA 3ATUA 3LDNA 5FPNA 4CQKA 4H5RA 5AQWA 5KK4A 1TI5A 1QQOA 5AQVA 1ZYWA 1NGGA 2ATBA 2BUPA 2LJMA 2VY6A 2KSKA 3D2FB 3BK3C 1BRZA 2JDQD 1OZZA 1WWNA 2GL1A 4UADE 2YC1C 1FH3A 3ATVA 2KGQA 1B7DA 2LY5A 2QWMA 1POIA 5BN9A 4H5WA 1I2VA 2N2RA 3KVGA 1QQMA 1PE4A 1ZVEA 4FSVA 5AQFA 1T1TA 3L56A 5BPLA 3LDLA 3KP0A 1LQHA 3CQXA 3E7UX 2E8AA 2E0HA 4UJ0A 2LN8A 1LQIA 3KOXA 2KYQA 3LDPA 5AQXA 3C7NB 1ATRA 5AQIA 1OMYA 1T0ZA 1DKGD 1MR4A 1VNAA 2SN3A 2YILA 1KV0A 3GL1A 2KJAA 4V1DC 5AQLA 5AQMA 5EY4A 4KBOA 2QWPA 1JZAA 1JXCA 1NH5A 5FPEA 1I6GA 1ICAA 1MYNA 1NGDA 1ZUTA 2GMOA 2YEOA 2KBJA 3KOYA 3QI7A 2M8BB 1I6FA 3HSCA 2E88A 5AQHA 2QXLA 2N66A 1JZBA 3D2EB 2E3FA 5FPDA 1VNBA 1CHZA 1SEGA 5AQKA 3GDQA 5AQUA 1NE5A 1S3XA 3KOZA 3M3ZA 2QWLA 5EX5A 1T7AA 1SN1A 1BA1A 1DJTA 1L4VA 5CY0A 5AQSA 3FZKA 1N4NA 1SNBA 3IUCA 1ZU3A 1ZYVA 1T7BA 1PTXA 5AQQA 2ASCA 2B3CA 3CW4A 3E7RL 3LDQA 5AQOA 5EVZA 4UAEF 4AAZA 1PX9A 3SF4D 4AEIA 3C7NA 3KP1A 3LDOA 4GNIA 2LJ7A 1BK8A 4UAFE 1BA0A 2KPYA 3I33A 1ZFUA 2LI7A 5FPMA 3PSMA 4IO8A 3GKUA 5F0XA 1NGFA 4HE7A 1HPMA 1NGAA 2QWRA 2YBRC 1HJOA 3D2FA 1BUPA 3D2EA 2LKBA 5AQRA 2KBKA 2YIPA 1NGBA 1QQNA 2V7ZA 1SN4A 1ATSA 2E2FA 1KAXA 2BRZA 3KOWA 3QFPA 1KAYA 4H5NA 1C55A 1NGJA 1JKZA 4AB0A 1BCGA 5BPMA 5AQNA 1GPSA 3L6QA 2A7TA 1NRBA 2LY6A 1KAZA 3R2VA 2LT8A 4KYPA 5F2RA 1NGCA 3FZMA 1BMRA 1I2UA 5BN8A 3FZHA 1NGHA 5AQPA 1HX1A 1LQQA 1P00A 3QMLA 1NGEA 2QW9A 1NPIA 5AQYA 1P0AA 2G2KA 5F1XA 2I61A 5AQGA 2B68A 3KHWA 3AY9A 3QFUA 1AYJA 3KC6A 5BPNA 2NY9X 1GPTA 2KBHA 1WT7A 1CN2A 1ZVGA 4FL9A 2MZ0A 4HHFA 1DQ7A 1UGLA 5EXWA 2MN5A 1K8BA 5AQTA 1WMTA 3FZLA 5AQZA 4H5VA 5AQJA 2LR3A 4H5TA 1NRAA 2QWNA
chains in the Genus database with same CATH topology
1NGIA 1YUWA 2D56A 2K35A 2QWOA 3FZFA 5AR0A 2KHOA 3JXUA 3A8YA 2QWQA 3L4IA 2MBKA 4HWIA 3FE1A 2YIOA 3ATUA 3LDNA 5FPNA 4H5RA 5AQWA 1QQOA 5AQVA 1NGGA 2BUPA 2VY6A 3D2FB 3BK3C 2JDQD 4UADE 3ATVA 2QWMA 1POIA 5BN9A 4H5WA 3KVGA 1QQMA 4FSVA 5AQFA 3L56A 5BPLA 3LDLA 3CQXA 2E8AA 2LN8A 3LDPA 5AQXA 3C7NB 1ATRA 5AQIA 1DKGD 2YILA 3GL1A 5AQLA 5AQMA 5EY4A 4KBOA 2QWPA 5FPEA 2GMOA 1NGDA 3QI7A 3HSCA 2E88A 5AQHA 2QXLA 3D2EB 5FPDA 5AQUA 5AQKA 3GDQA 1S3XA 3M3ZA 2QWLA 5EX5A 1BA1A 5AQSA 3FZKA 3IUCA 5AQQA 3CW4A 3LDQA 5AQOA 5EVZA 4UAEF 3SF4D 3C7NA 3LDOA 4GNIA 4UAFE 1BA0A 3I33A 5FPMA 4IO8A 5F0XA 1NGFA 1HPMA 1NGAA 2QWRA 1HJOA 3D2FA 1BUPA 3D2EA 5AQRA 2YIPA 1NGBA 1QQNA 2V7ZA 2E2FA 1ATSA 1KAXA 3QFPA 1KAYA 4H5NA 1NGJA 5BPMA 5AQNA 3L6QA 3R2VA 5F2RA 1KAZA 1NGCA 3FZMA 5BN8A 3FZHA 1NGHA 5AQPA 1HX1A 3QMLA 1NGEA 2QW9A 5AQYA 5F1XA 5AQGA 3KHWA 3AY9A 3QFUA 3KC6A 5BPNA 4FL9A 5EXWA 2MN5A 5AQTA 3FZLA 5AQZA 4H5VA 5AQJA 4H5TA 2QWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L56 A;  3KHW A;  4UAD E;  2GMO A;  2VY6 A;  3KC6 A;  4UAF E;  3R2V A;  2JDQ D;  3CW4 A;  4UAE F; 
#chains in the Genus database with same CATH topology
 1NGI A;  1XRS B;  1YUW A;  2D56 A;  2K35 A;  2QWO A;  1T7E A;  3FZF A;  1AHO A;  5AR0 A;  2KHO A;  3JXU A;  3A8Y A;  2QWQ A;  3L4I A;  1B3C A;  2E3G A;  1C56 A;  2MBK A;  2N69 A;  2NY8 X;  4HWI A;  2N2Q A;  3FE1 A;  2YIO A;  3ATU A;  3LDN A;  5FPN A;  4CQK A;  4H5R A;  5AQW A;  5KK4 A;  1TI5 A;  1QQO A;  5AQV A;  1ZYW A;  1NGG A;  2ATB A;  2BUP A;  2LJM A;  2VY6 A;  2KSK A;  3D2F B;  3BK3 C;  1BRZ A;  2JDQ D;  1OZZ A;  1WWN A;  2GL1 A;  4UAD E;  2YC1 C;  1FH3 A;  3ATV A;  2KGQ A;  1B7D A;  2LY5 A;  2QWM A;  1POI A;  5BN9 A;  4H5W A;  1I2V A;  2N2R A;  3KVG A;  1QQM A;  1PE4 A;  1ZVE A;  4FSV A;  5AQF A;  1T1T A;  3L56 A;  5BPL A;  3LDL A;  3KP0 A;  1LQH A;  3CQX A;  3E7U X;  2E8A A;  2E0H A;  4UJ0 A;  2LN8 A;  1LQI A;  3KOX A;  2KYQ A;  3LDP A;  5AQX A;  3C7N B;  1ATR A;  5AQI A;  1OMY A;  1T0Z A;  1DKG D;  1MR4 A;  1VNA A;  2SN3 A;  2YIL A;  1KV0 A;  3GL1 A;  2KJA A;  4V1D C;  5AQL A;  5AQM A;  5EY4 A;  4KBO A;  2QWP A;  1JZA A;  1JXC A;  1NH5 A;  5FPE A;  1I6G A;  1ICA A;  1MYN A;  1NGD A;  1ZUT A;  2GMO A;  2YEO A;  2KBJ A;  3KOY A;  3QI7 A;  2M8B B;  1I6F A;  3HSC A;  2E88 A;  5AQH A;  2QXL A;  2N66 A;  1JZB A;  3D2E B;  2E3F A;  5FPD A;  1VNB A;  1CHZ A;  1SEG A;  5AQK A;  3GDQ A;  5AQU A;  1NE5 A;  1S3X A;  3KOZ A;  3M3Z A;  2QWL A;  5EX5 A;  1T7A A;  1SN1 A;  1BA1 A;  1DJT A;  1L4V A;  5CY0 A;  5AQS A;  3FZK A;  1N4N A;  1SNB A;  3IUC A;  1ZU3 A;  1ZYV A;  1T7B A;  1PTX A;  5AQQ A;  2ASC A;  2B3C A;  3CW4 A;  3E7R L;  3LDQ A;  5AQO A;  5EVZ A;  4UAE F;  4AAZ A;  1PX9 A;  3SF4 D;  4AEI A;  3C7N A;  3KP1 A;  3LDO A;  4GNI A;  2LJ7 A;  1BK8 A;  4UAF E;  1BA0 A;  2KPY A;  3I33 A;  1ZFU A;  2LI7 A;  5FPM A;  3PSM A;  4IO8 A;  3GKU A;  5F0X A;  1NGF A;  4HE7 A;  1HPM A;  1NGA A;  2QWR A;  2YBR C;  1HJO A;  3D2F A;  1BUP A;  3D2E A;  2LKB A;  5AQR A;  2KBK A;  2YIP A;  1NGB A;  1QQN A;  2V7Z A;  1SN4 A;  1ATS A;  2E2F A;  1KAX A;  2BRZ A;  3KOW A;  3QFP A;  1KAY A;  4H5N A;  1C55 A;  1NGJ A;  1JKZ A;  4AB0 A;  1BCG A;  5BPM A;  5AQN A;  1GPS A;  3L6Q A;  2A7T A;  1NRB A;  2LY6 A;  1KAZ A;  3R2V A;  2LT8 A;  4KYP A;  5F2R A;  1NGC A;  3FZM A;  1BMR A;  1I2U A;  5BN8 A;  3FZH A;  1NGH A;  5AQP A;  1HX1 A;  1LQQ A;  1P00 A;  3QML A;  1NGE A;  2QW9 A;  1NPI A;  5AQY A;  1P0A A;  2G2K A;  5F1X A;  2I61 A;  5AQG A;  2B68 A;  3KHW A;  3AY9 A;  3QFU A;  1AYJ A;  3KC6 A;  5BPN A;  2NY9 X;  1GPT A;  2KBH A;  1WT7 A;  1CN2 A;  1ZVG A;  4FL9 A;  2MZ0 A;  4HHF A;  1DQ7 A;  1UGL A;  5EXW A;  2MN5 A;  1K8B A;  5AQT A;  1WMT A;  3FZL A;  5AQZ A;  4H5V A;  5AQJ A;  2LR3 A;  4H5T A;  1NRA A;  2QWN A; 
#chains in the Genus database with same CATH homology
 1NGI A;  1YUW A;  2D56 A;  2K35 A;  2QWO A;  3FZF A;  5AR0 A;  2KHO A;  3JXU A;  3A8Y A;  2QWQ A;  3L4I A;  2MBK A;  4HWI A;  3FE1 A;  2YIO A;  3ATU A;  3LDN A;  5FPN A;  4H5R A;  5AQW A;  1QQO A;  5AQV A;  1NGG A;  2BUP A;  2VY6 A;  3D2F B;  3BK3 C;  2JDQ D;  4UAD E;  3ATV A;  2QWM A;  1POI A;  5BN9 A;  4H5W A;  3KVG A;  1QQM A;  4FSV A;  5AQF A;  3L56 A;  5BPL A;  3LDL A;  3CQX A;  2E8A A;  2LN8 A;  3LDP A;  5AQX A;  3C7N B;  1ATR A;  5AQI A;  1DKG D;  2YIL A;  3GL1 A;  5AQL A;  5AQM A;  5EY4 A;  4KBO A;  2QWP A;  5FPE A;  2GMO A;  1NGD A;  3QI7 A;  3HSC A;  2E88 A;  5AQH A;  2QXL A;  3D2E B;  5FPD A;  5AQU A;  5AQK A;  3GDQ A;  1S3X A;  3M3Z A;  2QWL A;  5EX5 A;  1BA1 A;  5AQS A;  3FZK A;  3IUC A;  5AQQ A;  3CW4 A;  3LDQ A;  5AQO A;  5EVZ A;  4UAE F;  3SF4 D;  3C7N A;  3LDO A;  4GNI A;  4UAF E;  1BA0 A;  3I33 A;  5FPM A;  4IO8 A;  5F0X A;  1NGF A;  1HPM A;  1NGA A;  2QWR A;  1HJO A;  3D2F A;  1BUP A;  3D2E A;  5AQR A;  2YIP A;  1NGB A;  1QQN A;  2V7Z A;  2E2F A;  1ATS A;  1KAX A;  3QFP A;  1KAY A;  4H5N A;  1NGJ A;  5BPM A;  5AQN A;  3L6Q A;  3R2V A;  5F2R A;  1KAZ A;  1NGC A;  3FZM A;  5BN8 A;  3FZH A;  1NGH A;  5AQP A;  1HX1 A;  3QML A;  1NGE A;  2QW9 A;  5AQY A;  5F1X A;  5AQG A;  3KHW A;  3AY9 A;  3QFU A;  3KC6 A;  5BPN A;  4FL9 A;  5EXW A;  2MN5 A;  5AQT A;  3FZL A;  5AQZ A;  4H5V A;  5AQJ A;  4H5T A;  2QWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...