2VY6A

Two domains from the c-terminal region of influenza a virus polymerase pb2 subunit
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
204
structure length
196
Chain Sequence
EINGPESVLVNTYQWIIRNWETVKIQWSQNPTMLYNKMEFEPFQSLVPKAIRGQYSGFVRTLFQQMRDVLGTFDTTQIIKLLPFAAAPPKQSRMQFSSLTVNVRGSGMRILVRGNSPVFNYNKTTKRLTILGKDAGTLIEVESAVLRGFLILGKEDRRYGPALSINELSNLAKGEKANVLIGQGDVVLVMKRKRDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords POLYMERASE BASIC PROTEIN 2
publication title Host Determinant Residue Lysine 627 Lies on the Surface of a Discrete, Folded Domain of Influenza Virus Polymerase Pb2 Subunit
pubmed doi rcsb
source organism Influenza a virus
total genus 58
structure length 196
sequence length 204
ec nomenclature
pdb deposition date 2008-07-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.90 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 2vy6A02
3KC6A 3KHWA 4UAFE 2GMOA 4UADE 3L56A 2VY6A 4UAEF 2JDQD 3R2VA 3CW4A
chains in the Genus database with same CATH superfamily
1HJOA 4GNIA 1T7BA 1JXCA 1VNAA 1QQNA 2LKBA 4FSVA 4UAFE 3D2FA 2B3CA 3HSCA 5AQOA 4H5RA 4H5TA 5BPNA 3CQXA 3IUCA 2G2KA 5FPMA 3A8YA 5F2RA 1N4NA 1ZUTA 1QQOA 3KOYA 1JZAA 1BCGA 2M8BB 1NGJA 1I2VA 1OMYA 3ATUA 2LI7A 3C7NB 3GL1A 1WWNA 3D2EA 3E7RL 2SN3A 1BA1A 2QWOA 1AHOA 5AQKA 1WT7A 3BK3C 4AB0A 5BN8A 2MN5A 2V7ZA 2YEOA 3KC6A 4AEIA 5AQMA 1ZVGA 1S3XA 3L4IA 3M3ZA 1NGEA 1CHZA 1I6FA 1OZZA 3QFUA 1KAZA 1WMTA 2YILA 4FL9A 2QWNA 5AQTA 2YBRC 3SF4D 2KHOA 2N69A 2KSKA 1UGLA 2QWQA 3FZHA 3JXUA 4H5WA 3FE1A 2E2FA 2JDQD 1KV0A 5BPMA 5AQHA 5AQIA 2QW9A 3KHWA 2LJ7A 1K8BA 2VY6A 3KP1A 2YIOA 3LDLA 1FH3A 3LDOA 3CW4A 3QMLA 1DKGD 2LT8A 4KYPA 5AQWA 5KK4A 1LQHA 1ZFUA 3QFPA 1HX1A 1NGHA 4HHFA 3FZLA 3AY9A 5EVZA 3LDQA 1BUPA 2KGQA 3R2VA 3E7UX 1MYNA 1ZU3A 2KBJA 2NY8X 3C7NA 1CN2A 1VNBA 3FZFA 1T1TA 3PSMA 1NGDA 1T7EA 2YC1C 1YUWA 1ZVEA 2KJAA 2LJMA 3L6QA 1NGIA 3ATVA 5EXWA 2D56A 4UAEF 1ATSA 2LR3A 3I33A 1BMRA 4H5VA 2NY9X 5AQQA 2QWMA 1NGAA 2KPYA 1ATRA 1NPIA 1NH5A 2BUPA 2KYQA 5AQSA 5EY4A 3LDPA 1NRAA 5AR0A 1SEGA 1L4VA 1LQQA 2QWPA 2LY6A 2ATBA 2QXLA 1ZYWA 5AQXA 5AQZA 3LDNA 1NRBA 1SN1A 5AQNA 2ASCA 1DJTA 2QWLA 2YIPA 3KP0A 1I6GA 5FPEA 4AAZA 5AQFA 1ZYVA 2KBHA 1NE5A 1KAYA 1C55A 4HE7A 2MZ0A 1DQ7A 1XRSB 2N2RA 4UJ0A 1HPMA 3FZKA 1TI5A 2B68A 1KAXA 2GMOA 1QQMA 3FZMA 3KOXA 1SNBA 5AQUA 2A7TA 2GL1A 5EX5A 3D2FB 5BPLA 2N66A 3KVGA 1LQIA 1C56A 5AQVA 4HWIA 1JKZA 5FPDA 1JZBA 1PTXA 2LN8A 5CY0A 1BA0A 2E0HA 1P00A 2E8AA 4IO8A 1GPTA 1I2UA 1ICAA 1NGFA 4KBOA 1B7DA 2E3FA 5AQLA 5AQJA 2KBKA 3D2EB 5AQGA 4CQKA 1T7AA 2K35A 2E3GA 2QWRA 2N2QA 3KOWA 1POIA 5AQRA 1NGBA 5F0XA 1GPSA 1B3CA 5BN9A 3QI7A 1BK8A 4UADE 1PE4A 5AQPA 2E88A 1MR4A 3L56A 1P0AA 1PX9A 1T0ZA 4H5NA 3KOZA 3GKUA 5F1XA 1AYJA 2LY5A 2BRZA 1NGCA 2MBKA 5FPNA 1BRZA 2I61A 3GDQA 1NGGA 1SN4A 4V1DC 5AQYA
chains in the Genus database with same CATH topology
1HJOA 4GNIA 1QQNA 4FSVA 4UAFE 3D2FA 3HSCA 5AQOA 4H5RA 4H5TA 5BPNA 3CQXA 3IUCA 5FPMA 3A8YA 5F2RA 1QQOA 1NGJA 3ATUA 3C7NB 3GL1A 3D2EA 5AQKA 1BA1A 2QWOA 3BK3C 5BN8A 2MN5A 2V7ZA 3KC6A 5AQMA 1S3XA 3L4IA 3M3ZA 1NGEA 4FL9A 5AQIA 3QFUA 1KAZA 2YILA 5AQTA 2QWNA 3SF4D 2KHOA 3FZHA 2QWQA 4H5WA 3JXUA 3FE1A 2E2FA 2JDQD 5BPMA 5AQHA 2QW9A 3KHWA 2VY6A 2YIOA 3LDLA 3LDOA 3CW4A 3QMLA 1DKGD 5AQWA 3QFPA 1HX1A 1NGHA 3FZLA 3AY9A 5EVZA 3LDQA 1BUPA 3R2VA 3C7NA 3FZFA 1NGDA 5EXWA 1YUWA 3L6QA 1NGIA 3ATVA 2D56A 4UAEF 3I33A 1ATSA 4H5VA 5AQQA 2QWMA 1NGAA 1ATRA 2BUPA 5AQSA 5EY4A 3LDPA 5AR0A 2QWPA 2QXLA 5AQXA 5AQZA 3LDNA 5AQNA 2QWLA 2YIPA 5FPEA 5AQFA 1KAYA 1HPMA 3FZKA 1KAXA 2GMOA 1QQMA 3FZMA 5AQUA 5EX5A 3D2FB 5BPLA 3KVGA 5AQVA 4HWIA 5FPDA 2LN8A 1BA0A 4IO8A 2E8AA 1NGFA 4KBOA 5AQLA 5AQJA 3D2EB 5AQGA 2K35A 2QWRA 5AQRA 1POIA 5F0XA 1NGBA 5BN9A 3QI7A 4UADE 5AQPA 2E88A 3L56A 4H5NA 5F1XA 1NGCA 2MBKA 5FPNA 3GDQA 1NGGA 5AQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KC6 A;  3KHW A;  4UAF E;  2GMO A;  4UAD E;  3L56 A;  2VY6 A;  4UAE F;  2JDQ D;  3R2V A;  3CW4 A; 
#chains in the Genus database with same CATH topology
 1HJO A;  4GNI A;  1T7B A;  1JXC A;  1VNA A;  1QQN A;  2LKB A;  4FSV A;  4UAF E;  3D2F A;  2B3C A;  3HSC A;  5AQO A;  4H5R A;  4H5T A;  5BPN A;  3CQX A;  3IUC A;  2G2K A;  5FPM A;  3A8Y A;  5F2R A;  1N4N A;  1ZUT A;  1QQO A;  3KOY A;  1JZA A;  1BCG A;  2M8B B;  1NGJ A;  1I2V A;  1OMY A;  3ATU A;  2LI7 A;  3C7N B;  3GL1 A;  1WWN A;  3D2E A;  3E7R L;  2SN3 A;  1BA1 A;  2QWO A;  1AHO A;  5AQK A;  1WT7 A;  3BK3 C;  4AB0 A;  5BN8 A;  2MN5 A;  2V7Z A;  2YEO A;  3KC6 A;  4AEI A;  5AQM A;  1ZVG A;  1S3X A;  3L4I A;  3M3Z A;  1NGE A;  1CHZ A;  1I6F A;  1OZZ A;  3QFU A;  1KAZ A;  1WMT A;  2YIL A;  4FL9 A;  2QWN A;  5AQT A;  2YBR C;  3SF4 D;  2KHO A;  2N69 A;  2KSK A;  1UGL A;  2QWQ A;  3FZH A;  3JXU A;  4H5W A;  3FE1 A;  2E2F A;  2JDQ D;  1KV0 A;  5BPM A;  5AQH A;  5AQI A;  2QW9 A;  3KHW A;  2LJ7 A;  1K8B A;  2VY6 A;  3KP1 A;  2YIO A;  3LDL A;  1FH3 A;  3LDO A;  3CW4 A;  3QML A;  1DKG D;  2LT8 A;  4KYP A;  5AQW A;  5KK4 A;  1LQH A;  1ZFU A;  3QFP A;  1HX1 A;  1NGH A;  4HHF A;  3FZL A;  3AY9 A;  5EVZ A;  3LDQ A;  1BUP A;  2KGQ A;  3R2V A;  3E7U X;  1MYN A;  1ZU3 A;  2KBJ A;  2NY8 X;  3C7N A;  1CN2 A;  1VNB A;  3FZF A;  1T1T A;  3PSM A;  1NGD A;  1T7E A;  2YC1 C;  1YUW A;  1ZVE A;  2KJA A;  2LJM A;  3L6Q A;  1NGI A;  3ATV A;  5EXW A;  2D56 A;  4UAE F;  1ATS A;  2LR3 A;  3I33 A;  1BMR A;  4H5V A;  2NY9 X;  5AQQ A;  2QWM A;  1NGA A;  2KPY A;  1ATR A;  1NPI A;  1NH5 A;  2BUP A;  2KYQ A;  5AQS A;  5EY4 A;  3LDP A;  1NRA A;  5AR0 A;  1SEG A;  1L4V A;  1LQQ A;  2QWP A;  2LY6 A;  2ATB A;  2QXL A;  1ZYW A;  5AQX A;  5AQZ A;  3LDN A;  1NRB A;  1SN1 A;  5AQN A;  2ASC A;  1DJT A;  2QWL A;  2YIP A;  3KP0 A;  1I6G A;  5FPE A;  4AAZ A;  5AQF A;  1ZYV A;  2KBH A;  1NE5 A;  1KAY A;  1C55 A;  4HE7 A;  2MZ0 A;  1DQ7 A;  1XRS B;  2N2R A;  4UJ0 A;  1HPM A;  3FZK A;  1TI5 A;  2B68 A;  1KAX A;  2GMO A;  1QQM A;  3FZM A;  3KOX A;  1SNB A;  5AQU A;  2A7T A;  2GL1 A;  5EX5 A;  3D2F B;  5BPL A;  2N66 A;  3KVG A;  1LQI A;  1C56 A;  5AQV A;  4HWI A;  1JKZ A;  5FPD A;  1JZB A;  1PTX A;  2LN8 A;  5CY0 A;  1BA0 A;  2E0H A;  1P00 A;  2E8A A;  4IO8 A;  1GPT A;  1I2U A;  1ICA A;  1NGF A;  4KBO A;  1B7D A;  2E3F A;  5AQL A;  5AQJ A;  2KBK A;  3D2E B;  5AQG A;  4CQK A;  1T7A A;  2K35 A;  2E3G A;  2QWR A;  2N2Q A;  3KOW A;  1POI A;  5AQR A;  1NGB A;  5F0X A;  1GPS A;  1B3C A;  5BN9 A;  3QI7 A;  1BK8 A;  4UAD E;  1PE4 A;  5AQP A;  2E88 A;  1MR4 A;  3L56 A;  1P0A A;  1PX9 A;  1T0Z A;  4H5N A;  3KOZ A;  3GKU A;  5F1X A;  1AYJ A;  2LY5 A;  2BRZ A;  1NGC A;  2MBK A;  5FPN A;  1BRZ A;  2I61 A;  3GDQ A;  1NGG A;  1SN4 A;  4V1D C;  5AQY A; 
#chains in the Genus database with same CATH homology
 1HJO A;  4GNI A;  1QQN A;  4FSV A;  4UAF E;  3D2F A;  3HSC A;  5AQO A;  4H5R A;  4H5T A;  5BPN A;  3CQX A;  3IUC A;  5FPM A;  3A8Y A;  5F2R A;  1QQO A;  1NGJ A;  3ATU A;  3C7N B;  3GL1 A;  3D2E A;  5AQK A;  1BA1 A;  2QWO A;  3BK3 C;  5BN8 A;  2MN5 A;  2V7Z A;  3KC6 A;  5AQM A;  1S3X A;  3L4I A;  3M3Z A;  1NGE A;  4FL9 A;  5AQI A;  3QFU A;  1KAZ A;  2YIL A;  5AQT A;  2QWN A;  3SF4 D;  2KHO A;  3FZH A;  2QWQ A;  4H5W A;  3JXU A;  3FE1 A;  2E2F A;  2JDQ D;  5BPM A;  5AQH A;  2QW9 A;  3KHW A;  2VY6 A;  2YIO A;  3LDL A;  3LDO A;  3CW4 A;  3QML A;  1DKG D;  5AQW A;  3QFP A;  1HX1 A;  1NGH A;  3FZL A;  3AY9 A;  5EVZ A;  3LDQ A;  1BUP A;  3R2V A;  3C7N A;  3FZF A;  1NGD A;  5EXW A;  1YUW A;  3L6Q A;  1NGI A;  3ATV A;  2D56 A;  4UAE F;  3I33 A;  1ATS A;  4H5V A;  5AQQ A;  2QWM A;  1NGA A;  1ATR A;  2BUP A;  5AQS A;  5EY4 A;  3LDP A;  5AR0 A;  2QWP A;  2QXL A;  5AQX A;  5AQZ A;  3LDN A;  5AQN A;  2QWL A;  2YIP A;  5FPE A;  5AQF A;  1KAY A;  1HPM A;  3FZK A;  1KAX A;  2GMO A;  1QQM A;  3FZM A;  5AQU A;  5EX5 A;  3D2F B;  5BPL A;  3KVG A;  5AQV A;  4HWI A;  5FPD A;  2LN8 A;  1BA0 A;  4IO8 A;  2E8A A;  1NGF A;  4KBO A;  5AQL A;  5AQJ A;  3D2E B;  5AQG A;  2K35 A;  2QWR A;  5AQR A;  1POI A;  5F0X A;  1NGB A;  5BN9 A;  3QI7 A;  4UAD E;  5AQP A;  2E88 A;  3L56 A;  4H5N A;  5F1X A;  1NGC A;  2MBK A;  5FPN A;  3GDQ A;  1NGG A;  5AQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...