1AYJA

Determination of the three-dimensional solution structure of raphanus sativus antifungal protein 1 (rs-afp1) by 1h nmr, 20 structures
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
51
structure length
51
Chain Sequence
EKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fungicide
molecule keywords ANTIFUNGAL PROTEIN 1
publication title Determination of the three-dimensional solution structure of Raphanus sativus antifungal protein 1 by 1H NMR.
pubmed doi rcsb
total genus 17
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1997-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1ayjA00
2SN3A 1I2VA 2YC1C 1I2UA 1AHOA 1JZBA 1PX9A 1ZVGA 1LQIA 2A7TA 2I61A 1B7DA 2KYQA 1SEGA 1BK8A 1TI5A 2LJ7A 1NRAA 4KYPA 4CQKA 2LR3A 1ZU3A 4AB0A 1I6GA 2ASCA 1DQ7A 1LQHA 1BRZA 2KPYA 1CHZA 1JKZA 2KJAA 2ATBA 1L4VA 2GL1A 4V1DC 2LKBA 1B3CA 1T0ZA 1SN1A 2BRZA 2YEOA 1C55A 1N4NA 2KGQA 1VNBA 1SNBA 2N2RA 1ZYWA 2MZ0A 1T7BA 1WMTA 3E7UX 4UJ0A 1GPTA 1T7EA 2KBJA 1NH5A 4HHFA 2KSKA 1DJTA 1PE4A 1VNAA 2KBKA 1ICAA 1LQQA 2B68A 2B3CA 2LY5A 1P00A 1NRBA 1OZZA 1NE5A 2LI7A 4AEIA 1ZYVA 2N69A 1T1TA 2LY6A 1I6FA 2N66A 3E7RL 1JZAA 1P0AA 1MR4A 1T7AA 1ZUTA 1WWNA 1PTXA 2LJMA 1SN4A 5KK4A 1BCGA 2KBHA 2LT8A 1ZFUA 4AAZA 2M8BB 1MYNA 1AYJA 2YBRC 1ZVEA 4HE7A 1C56A 1KV0A 1FH3A 2E3GA 1JXCA 1CN2A 2NY8X 1GPSA 2N2QA 5CY0A 3PSMA 2E3FA 1NPIA 2E0HA 1OMYA 1BMRA 2NY9X 1WT7A
chains in the Genus database with same CATH superfamily
2SN3A 4UAEF 1QQNA 1I2VA 2BUPA 2E8AA 4UAFE 2YC1C 1I2UA 4FSVA 2QWLA 3KHWA 1AHOA 1JZBA 3IUCA 3D2FB 3GL1A 1PX9A 1ZVGA 1LQIA 4KBOA 2MN5A 1DKGD 3ATVA 2A7TA 2I61A 3A8YA 1HJOA 2QW9A 1B7DA 2KYQA 5EY4A 2K35A 1SEGA 4HWIA 1BK8A 3LDNA 5AQLA 5AQHA 1TI5A 2LJ7A 1NRAA 4KYPA 1POIA 5AQGA 4CQKA 3KOZA 2QWPA 3QFUA 4GNIA 1NGEA 2LR3A 1ZU3A 5AQKA 4AB0A 4AEIA 1I6GA 2ASCA 1DQ7A 5BN9A 1LQHA 2E88A 1BRZA 2KPYA 3R2VA 1CHZA 2KHOA 3ATUA 3KC6A 5AQIA 5BN8A 1JKZA 2KJAA 3GDQA 3FZHA 2ATBA 1NGAA 1L4VA 2GL1A 4V1DC 2LKBA 2YILA 3KOWA 1B3CA 2YIOA 1HPMA 2LN8A 3KP0A 3L6QA 3I33A 1T0ZA 1SN1A 4IO8A 2E2FA 1BA0A 2BRZA 2JDQD 2YEOA 3FZFA 1C55A 2MBKA 4H5TA 1BUPA 4H5WA 1N4NA 1KAXA 5AQXA 2KGQA 1KAZA 1NGJA 1VNBA 1SNBA 2N2RA 1ZYWA 2MZ0A 3JXUA 1S3XA 1QQOA 1T7BA 1WMTA 3E7UX 1HX1A 2QWOA 4UJ0A 1QQMA 5AQOA 1GPTA 5AQRA 4UADE 5AQMA 5AQWA 1T7EA 2QWRA 2KBJA 2YIPA 2QXLA 4H5NA 3LDPA 5AQYA 3KP1A 1NH5A 2G2KA 4HHFA 3FZMA 5FPMA 2KSKA 5FPNA 5AQVA 2QWMA 1K8BA 1DJTA 1NGBA 1PE4A 1UGLA 1VNAA 2D56A 2KBKA 5BPMA 1ICAA 1LQQA 3QI7A 5EVZA 2B68A 2B3CA 2LY5A 1ATSA 3LDLA 1YUWA 5AQFA 3KOXA 1P00A 3L4IA 1NRBA 1OZZA 1NE5A 3KVGA 5AQZA 2LI7A 3L56A 1ZYVA 2N69A 3CQXA 3AY9A 1T1TA 2LY6A 1I6FA 3FZLA 4FL9A 2N66A 3C7NA 3E7RL 1JZAA 1P0AA 1MR4A 1NGDA 3BK3C 3HSCA 1T7AA 5AQJA 1ZUTA 1WWNA 1NGFA 1PTXA 5EXWA 2LJMA 5F1XA 3FZKA 1SN4A 3LDOA 5AQTA 5EX5A 2QWNA 3KOYA 1NGGA 5KK4A 1BCGA 2KBHA 2LT8A 1ZFUA 3C7NB 3QMLA 5AQSA 2M8BB 4AAZA 1MYNA 1AYJA 1BA1A 2YBRC 5F0XA 3D2EA 5AQUA 1KAYA 3QFPA 4H5VA 1ZVEA 4HE7A 5AQPA 5BPNA 2VY6A 3GKUA 3M3ZA 1C56A 1KV0A 5FPEA 5F2RA 3FE1A 1FH3A 2E3GA 1JXCA 3LDQA 2V7ZA 3SF4D 1CN2A 5AQQA 5AR0A 2GMOA 5BPLA 2NY8X 1GPSA 2N2QA 5CY0A 1NGCA 4H5RA 3PSMA 3D2EB 2E3FA 1ATRA 1NGHA 1NPIA 3D2FA 2E0HA 3CW4A 5FPDA 5AQNA 1OMYA 1BMRA 1NGIA 2NY9X 1WT7A 1XRSB 2QWQA
chains in the Genus database with same CATH topology
2SN3A 1I2VA 2YC1C 1I2UA 1AHOA 1JZBA 1PX9A 1ZVGA 1LQIA 2A7TA 2I61A 1B7DA 2KYQA 1SEGA 1BK8A 1TI5A 2LJ7A 1NRAA 4KYPA 4CQKA 2LR3A 1ZU3A 4AB0A 1I6GA 2ASCA 1DQ7A 1LQHA 1BRZA 2KPYA 1CHZA 1JKZA 2KJAA 2ATBA 1L4VA 2GL1A 4V1DC 2LKBA 1B3CA 1T0ZA 1SN1A 2BRZA 2YEOA 1C55A 1N4NA 2KGQA 1VNBA 1SNBA 2N2RA 1ZYWA 2MZ0A 1T7BA 1WMTA 3E7UX 4UJ0A 1GPTA 1T7EA 2KBJA 1NH5A 4HHFA 2KSKA 1DJTA 1PE4A 1VNAA 2KBKA 1ICAA 1LQQA 2B68A 2B3CA 2LY5A 1P00A 1NRBA 1OZZA 1NE5A 2LI7A 4AEIA 1ZYVA 2N69A 1T1TA 2LY6A 1I6FA 2N66A 3E7RL 1JZAA 1P0AA 1MR4A 1T7AA 1ZUTA 1WWNA 1PTXA 2LJMA 1SN4A 5KK4A 1BCGA 2KBHA 2LT8A 1ZFUA 4AAZA 2M8BB 1MYNA 1AYJA 2YBRC 1ZVEA 4HE7A 1C56A 1KV0A 1FH3A 2E3GA 1JXCA 1CN2A 2NY8X 1GPSA 2N2QA 5CY0A 3PSMA 2E3FA 1NPIA 2E0HA 1OMYA 1BMRA 2NY9X 1WT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SN3 A;  1I2V A;  2YC1 C;  1I2U A;  1AHO A;  1JZB A;  1PX9 A;  1ZVG A;  1LQI A;  2A7T A;  2I61 A;  1B7D A;  2KYQ A;  1SEG A;  1BK8 A;  1TI5 A;  2LJ7 A;  1NRA A;  4KYP A;  4CQK A;  2LR3 A;  1ZU3 A;  4AB0 A;  1I6G A;  2ASC A;  1DQ7 A;  1LQH A;  1BRZ A;  2KPY A;  1CHZ A;  1JKZ A;  2KJA A;  2ATB A;  1L4V A;  2GL1 A;  4V1D C;  2LKB A;  1B3C A;  1T0Z A;  1SN1 A;  2BRZ A;  2YEO A;  1C55 A;  1N4N A;  2KGQ A;  1VNB A;  1SNB A;  2N2R A;  1ZYW A;  2MZ0 A;  1T7B A;  1WMT A;  3E7U X;  4UJ0 A;  1GPT A;  1T7E A;  2KBJ A;  1NH5 A;  4HHF A;  2KSK A;  1DJT A;  1PE4 A;  1VNA A;  2KBK A;  1ICA A;  1LQQ A;  2B68 A;  2B3C A;  2LY5 A;  1P00 A;  1NRB A;  1OZZ A;  1NE5 A;  2LI7 A;  4AEI A;  1ZYV A;  2N69 A;  1T1T A;  2LY6 A;  1I6F A;  2N66 A;  3E7R L;  1JZA A;  1P0A A;  1MR4 A;  1T7A A;  1ZUT A;  1WWN A;  1PTX A;  2LJM A;  1SN4 A;  5KK4 A;  1BCG A;  2KBH A;  2LT8 A;  1ZFU A;  4AAZ A;  2M8B B;  1MYN A;  1AYJ A;  2YBR C;  1ZVE A;  4HE7 A;  1C56 A;  1KV0 A;  1FH3 A;  2E3G A;  1JXC A;  1CN2 A;  2NY8 X;  1GPS A;  2N2Q A;  5CY0 A;  3PSM A;  2E3F A;  1NPI A;  2E0H A;  1OMY A;  1BMR A;  2NY9 X;  1WT7 A; 
#chains in the Genus database with same CATH topology
 2SN3 A;  4UAE F;  1QQN A;  1I2V A;  2BUP A;  2E8A A;  4UAF E;  2YC1 C;  1I2U A;  4FSV A;  2QWL A;  3KHW A;  1AHO A;  1JZB A;  3IUC A;  3D2F B;  3GL1 A;  1PX9 A;  1ZVG A;  1LQI A;  4KBO A;  2MN5 A;  1DKG D;  3ATV A;  2A7T A;  2I61 A;  3A8Y A;  1HJO A;  2QW9 A;  1B7D A;  2KYQ A;  5EY4 A;  2K35 A;  1SEG A;  4HWI A;  1BK8 A;  3LDN A;  5AQL A;  5AQH A;  1TI5 A;  2LJ7 A;  1NRA A;  4KYP A;  1POI A;  5AQG A;  4CQK A;  3KOZ A;  2QWP A;  3QFU A;  4GNI A;  1NGE A;  2LR3 A;  1ZU3 A;  5AQK A;  4AB0 A;  4AEI A;  1I6G A;  2ASC A;  1DQ7 A;  5BN9 A;  1LQH A;  2E88 A;  1BRZ A;  2KPY A;  3R2V A;  1CHZ A;  2KHO A;  3ATU A;  3KC6 A;  5AQI A;  5BN8 A;  1JKZ A;  2KJA A;  3GDQ A;  3FZH A;  2ATB A;  1NGA A;  1L4V A;  2GL1 A;  4V1D C;  2LKB A;  2YIL A;  3KOW A;  1B3C A;  2YIO A;  1HPM A;  2LN8 A;  3KP0 A;  3L6Q A;  3I33 A;  1T0Z A;  1SN1 A;  4IO8 A;  2E2F A;  1BA0 A;  2BRZ A;  2JDQ D;  2YEO A;  3FZF A;  1C55 A;  2MBK A;  4H5T A;  1BUP A;  4H5W A;  1N4N A;  1KAX A;  5AQX A;  2KGQ A;  1KAZ A;  1NGJ A;  1VNB A;  1SNB A;  2N2R A;  1ZYW A;  2MZ0 A;  3JXU A;  1S3X A;  1QQO A;  1T7B A;  1WMT A;  3E7U X;  1HX1 A;  2QWO A;  4UJ0 A;  1QQM A;  5AQO A;  1GPT A;  5AQR A;  4UAD E;  5AQM A;  5AQW A;  1T7E A;  2QWR A;  2KBJ A;  2YIP A;  2QXL A;  4H5N A;  3LDP A;  5AQY A;  3KP1 A;  1NH5 A;  2G2K A;  4HHF A;  3FZM A;  5FPM A;  2KSK A;  5FPN A;  5AQV A;  2QWM A;  1K8B A;  1DJT A;  1NGB A;  1PE4 A;  1UGL A;  1VNA A;  2D56 A;  2KBK A;  5BPM A;  1ICA A;  1LQQ A;  3QI7 A;  5EVZ A;  2B68 A;  2B3C A;  2LY5 A;  1ATS A;  3LDL A;  1YUW A;  5AQF A;  3KOX A;  1P00 A;  3L4I A;  1NRB A;  1OZZ A;  1NE5 A;  3KVG A;  5AQZ A;  2LI7 A;  3L56 A;  1ZYV A;  2N69 A;  3CQX A;  3AY9 A;  1T1T A;  2LY6 A;  1I6F A;  3FZL A;  4FL9 A;  2N66 A;  3C7N A;  3E7R L;  1JZA A;  1P0A A;  1MR4 A;  1NGD A;  3BK3 C;  3HSC A;  1T7A A;  5AQJ A;  1ZUT A;  1WWN A;  1NGF A;  1PTX A;  5EXW A;  2LJM A;  5F1X A;  3FZK A;  1SN4 A;  3LDO A;  5AQT A;  5EX5 A;  2QWN A;  3KOY A;  1NGG A;  5KK4 A;  1BCG A;  2KBH A;  2LT8 A;  1ZFU A;  3C7N B;  3QML A;  5AQS A;  2M8B B;  4AAZ A;  1MYN A;  1AYJ A;  1BA1 A;  2YBR C;  5F0X A;  3D2E A;  5AQU A;  1KAY A;  3QFP A;  4H5V A;  1ZVE A;  4HE7 A;  5AQP A;  5BPN A;  2VY6 A;  3GKU A;  3M3Z A;  1C56 A;  1KV0 A;  5FPE A;  5F2R A;  3FE1 A;  1FH3 A;  2E3G A;  1JXC A;  3LDQ A;  2V7Z A;  3SF4 D;  1CN2 A;  5AQQ A;  5AR0 A;  2GMO A;  5BPL A;  2NY8 X;  1GPS A;  2N2Q A;  5CY0 A;  1NGC A;  4H5R A;  3PSM A;  3D2E B;  2E3F A;  1ATR A;  1NGH A;  1NPI A;  3D2F A;  2E0H A;  3CW4 A;  5FPD A;  5AQN A;  1OMY A;  1BMR A;  1NGI A;  2NY9 X;  1WT7 A;  1XRS B;  2QWQ A; 
#chains in the Genus database with same CATH homology
 2SN3 A;  1I2V A;  2YC1 C;  1I2U A;  1AHO A;  1JZB A;  1PX9 A;  1ZVG A;  1LQI A;  2A7T A;  2I61 A;  1B7D A;  2KYQ A;  1SEG A;  1BK8 A;  1TI5 A;  2LJ7 A;  1NRA A;  4KYP A;  4CQK A;  2LR3 A;  1ZU3 A;  4AB0 A;  1I6G A;  2ASC A;  1DQ7 A;  1LQH A;  1BRZ A;  2KPY A;  1CHZ A;  1JKZ A;  2KJA A;  2ATB A;  1L4V A;  2GL1 A;  4V1D C;  2LKB A;  1B3C A;  1T0Z A;  1SN1 A;  2BRZ A;  2YEO A;  1C55 A;  1N4N A;  2KGQ A;  1VNB A;  1SNB A;  2N2R A;  1ZYW A;  2MZ0 A;  1T7B A;  1WMT A;  3E7U X;  4UJ0 A;  1GPT A;  1T7E A;  2KBJ A;  1NH5 A;  4HHF A;  2KSK A;  1DJT A;  1PE4 A;  1VNA A;  2KBK A;  1ICA A;  1LQQ A;  2B68 A;  2B3C A;  2LY5 A;  1P00 A;  1NRB A;  1OZZ A;  1NE5 A;  2LI7 A;  4AEI A;  1ZYV A;  2N69 A;  1T1T A;  2LY6 A;  1I6F A;  2N66 A;  3E7R L;  1JZA A;  1P0A A;  1MR4 A;  1T7A A;  1ZUT A;  1WWN A;  1PTX A;  2LJM A;  1SN4 A;  5KK4 A;  1BCG A;  2KBH A;  2LT8 A;  1ZFU A;  4AAZ A;  2M8B B;  1MYN A;  1AYJ A;  2YBR C;  1ZVE A;  4HE7 A;  1C56 A;  1KV0 A;  1FH3 A;  2E3G A;  1JXC A;  1CN2 A;  2NY8 X;  1GPS A;  2N2Q A;  5CY0 A;  3PSM A;  2E3F A;  1NPI A;  2E0H A;  1OMY A;  1BMR A;  2NY9 X;  1WT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...