1B3CA

Solution structure of a beta-neurotoxin from the new world scorpion centruroides sculpturatus ewing
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
64
structure length
64
Chain Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PROTEIN (NEUROTOXIN CSE-I)
publication title Solution structure of a beta-neurotoxin from the New World scorpion Centruroides sculpturatus Ewing.
pubmed doi rcsb
total genus 7
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 1998-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1b3cA00
4AEIA 1AYJA 4AB0A 5CY0A 1AHOA 4HE7A 1T7BA 2KYQA 1LQQA 1SNBA 1P0AA 1PTXA 1I2UA 2KPYA 1BRZA 1L4VA 2E0HA 2LY5A 1JKZA 1LQHA 1ZYVA 2ATBA 1ZYWA 2KGQA 1SEGA 1C55A 1FH3A 1NH5A 1ZVEA 2M8BB 3PSMA 2MZ0A 1WT7A 2E3FA 1KV0A 1VNBA 1B3CA 1T0ZA 1JZBA 2N2RA 2SN3A 2KJAA 1CN2A 1BK8A 1MYNA 2E3GA 1WMTA 2N2QA 2N69A 1LQIA 2KBKA 2LT8A 2LR3A 2LJMA 1NE5A 1C56A 2LY6A 4CQKA 1PX9A 2YEOA 1GPSA 1ICAA 1SN1A 1I2VA 2YC1C 1ZVGA 1GPTA 1I6GA 1NRAA 1ZFUA 4HHFA 1JZAA 2NY9X 1NPIA 2BRZA 1WWNA 1CHZA 1PE4A 2LKBA 2LI7A 1TI5A 2KSKA 1BCGA 2B3CA 2I61A 4UJ0A 2A7TA 1JXCA 2KBHA 2ASCA 2NY8X 2KBJA 3E7UX 1OMYA 1I6FA 5KK4A 1SN4A 1BMRA 1ZU3A 1DJTA 1DQ7A 2N66A 4AAZA 1T7AA 4V1DC 4KYPA 1N4NA 1ZUTA 1MR4A 1T1TA 1NRBA 3E7RL 1B7DA 1VNAA 1P00A 1OZZA 1T7EA 2YBRC 2B68A 2LJ7A 2GL1A
chains in the Genus database with same CATH superfamily
4AEIA 1AYJA 4AB0A 5CY0A 1AHOA 3QFUA 3KP0A 3LDLA 1T7BA 1HPMA 2KYQA 4HE7A 1LQQA 1SNBA 3KHWA 1P0AA 1PTXA 2GMOA 1I2UA 2KPYA 3GL1A 1POIA 3D2EA 3QFPA 2E0HA 5FPDA 1BRZA 1L4VA 2LY5A 2QWPA 1JKZA 1NGJA 3LDOA 3D2FB 1LQHA 3QI7A 4FL9A 1ZYVA 2ATBA 3L4IA 2BUPA 1ZYWA 3KOYA 1NGEA 1QQOA 1SEGA 2KGQA 2QWNA 1C55A 1FH3A 1NH5A 2YIOA 1ZVEA 1KAXA 5AQMA 5AQSA 2QWQA 2M8BB 5FPMA 3A8YA 3KVGA 3FZHA 5AQNA 5BN9A 1NGBA 3PSMA 1NGAA 5AQXA 2MZ0A 5AQWA 1WT7A 1KV0A 2E3FA 3CQXA 3D2EB 3R2VA 4H5TA 5AQUA 3SF4D 5F0XA 3KP1A 5AR0A 1VNBA 5F2RA 4KBOA 1BUPA 2K35A 2QXLA 1T0ZA 4UAEF 1S3XA 5BPLA 1B3CA 5AQOA 1JZBA 2N2RA 3FZKA 3KOZA 2SN3A 3M3ZA 5AQZA 2KJAA 1CN2A 1NGHA 5AQTA 4H5WA 1BK8A 1MYNA 2E3GA 1WMTA 2KHOA 2N2QA 2N69A 1LQIA 1XRSB 2V7ZA 5AQVA 5FPEA 1QQNA 2KBKA 2LT8A 3FZFA 3CW4A 2LR3A 1ATRA 2LJMA 1NE5A 3GKUA 5BPNA 5AQRA 4IO8A 1C56A 2LY6A 2D56A 1NGDA 4CQKA 1HX1A 1PX9A 3FZLA 3LDNA 2YEOA 2E2FA 3I33A 3L56A 5FPNA 5BPMA 1SN1A 1GPSA 1ICAA 1I2VA 5AQJA 2QWMA 3C7NA 2G2KA 2YC1C 4H5VA 1ZVGA 4H5RA 4HWIA 1HJOA 1GPTA 5AQQA 5AQPA 1I6GA 1KAZA 2JDQD 3D2FA 2E88A 1NRAA 1ZFUA 4HHFA 1JZAA 2NY9X 4FSVA 1NPIA 2BRZA 5AQKA 1WWNA 1CHZA 3BK3C 3GDQA 1PE4A 2LKBA 3KOXA 2LI7A 1BA1A 2QW9A 1TI5A 2KSKA 5F1XA 2YIPA 3HSCA 3FZMA 3L6QA 4GNIA 1NGGA 2LN8A 1BCGA 2B3CA 2I61A 4UJ0A 2A7TA 1NGIA 5AQGA 1JXCA 2KBHA 2MN5A 5EX5A 2ASCA 2NY8X 2KBJA 2E8AA 3E7UX 5AQFA 5EY4A 1OMYA 5AQHA 3IUCA 1I6FA 3QMLA 2MBKA 5KK4A 1ATSA 1SN4A 4UAFE 1BMRA 1YUWA 5AQYA 1BA0A 1DJTA 1ZU3A 1DQ7A 2QWRA 5AQLA 2N66A 1NGFA 3FE1A 1KAYA 2QWOA 4AAZA 1T7AA 3ATUA 4V1DC 3LDPA 5EVZA 4KYPA 1N4NA 3KOWA 4H5NA 5BN8A 1NGCA 3KC6A 3LDQA 1ZUTA 2YILA 3C7NB 5AQIA 5EXWA 3AY9A 1MR4A 1T1TA 3JXUA 4UADE 3ATVA 1NRBA 1UGLA 3E7RL 1B7DA 1VNAA 1P00A 2QWLA 1OZZA 1K8BA 1DKGD 1T7EA 2YBRC 1QQMA 2B68A 2LJ7A 2GL1A 2VY6A
chains in the Genus database with same CATH topology
4AEIA 1AYJA 4AB0A 5CY0A 1AHOA 4HE7A 1T7BA 2KYQA 1LQQA 1SNBA 1P0AA 1PTXA 1I2UA 2KPYA 1BRZA 1L4VA 2E0HA 2LY5A 1JKZA 1LQHA 1ZYVA 2ATBA 1ZYWA 2KGQA 1SEGA 1C55A 1FH3A 1NH5A 1ZVEA 2M8BB 3PSMA 2MZ0A 1WT7A 2E3FA 1KV0A 1VNBA 1B3CA 1T0ZA 1JZBA 2N2RA 2SN3A 2KJAA 1CN2A 1BK8A 1MYNA 2E3GA 1WMTA 2N2QA 2N69A 1LQIA 2KBKA 2LT8A 2LR3A 2LJMA 1NE5A 1C56A 2LY6A 4CQKA 1PX9A 2YEOA 1GPSA 1ICAA 1SN1A 1I2VA 2YC1C 1ZVGA 1GPTA 1I6GA 1NRAA 1ZFUA 4HHFA 1JZAA 2NY9X 1NPIA 2BRZA 1WWNA 1CHZA 1PE4A 2LKBA 2LI7A 1TI5A 2KSKA 1BCGA 2B3CA 2I61A 4UJ0A 2A7TA 1JXCA 2KBHA 2ASCA 2NY8X 2KBJA 3E7UX 1OMYA 1I6FA 5KK4A 1SN4A 1BMRA 1ZU3A 1DJTA 1DQ7A 2N66A 4AAZA 1T7AA 4V1DC 4KYPA 1N4NA 1ZUTA 1MR4A 1T1TA 1NRBA 3E7RL 1B7DA 1VNAA 1P00A 1OZZA 1T7EA 2YBRC 2B68A 2LJ7A 2GL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AEI A;  1AYJ A;  4AB0 A;  5CY0 A;  1AHO A;  4HE7 A;  1T7B A;  2KYQ A;  1LQQ A;  1SNB A;  1P0A A;  1PTX A;  1I2U A;  2KPY A;  1BRZ A;  1L4V A;  2E0H A;  2LY5 A;  1JKZ A;  1LQH A;  1ZYV A;  2ATB A;  1ZYW A;  2KGQ A;  1SEG A;  1C55 A;  1FH3 A;  1NH5 A;  1ZVE A;  2M8B B;  3PSM A;  2MZ0 A;  1WT7 A;  2E3F A;  1KV0 A;  1VNB A;  1B3C A;  1T0Z A;  1JZB A;  2N2R A;  2SN3 A;  2KJA A;  1CN2 A;  1BK8 A;  1MYN A;  2E3G A;  1WMT A;  2N2Q A;  2N69 A;  1LQI A;  2KBK A;  2LT8 A;  2LR3 A;  2LJM A;  1NE5 A;  1C56 A;  2LY6 A;  4CQK A;  1PX9 A;  2YEO A;  1GPS A;  1ICA A;  1SN1 A;  1I2V A;  2YC1 C;  1ZVG A;  1GPT A;  1I6G A;  1NRA A;  1ZFU A;  4HHF A;  1JZA A;  2NY9 X;  1NPI A;  2BRZ A;  1WWN A;  1CHZ A;  1PE4 A;  2LKB A;  2LI7 A;  1TI5 A;  2KSK A;  1BCG A;  2B3C A;  2I61 A;  4UJ0 A;  2A7T A;  1JXC A;  2KBH A;  2ASC A;  2NY8 X;  2KBJ A;  3E7U X;  1OMY A;  1I6F A;  5KK4 A;  1SN4 A;  1BMR A;  1ZU3 A;  1DJT A;  1DQ7 A;  2N66 A;  4AAZ A;  1T7A A;  4V1D C;  4KYP A;  1N4N A;  1ZUT A;  1MR4 A;  1T1T A;  1NRB A;  3E7R L;  1B7D A;  1VNA A;  1P00 A;  1OZZ A;  1T7E A;  2YBR C;  2B68 A;  2LJ7 A;  2GL1 A; 
#chains in the Genus database with same CATH topology
 4AEI A;  1AYJ A;  4AB0 A;  5CY0 A;  1AHO A;  3QFU A;  3KP0 A;  3LDL A;  1T7B A;  1HPM A;  2KYQ A;  4HE7 A;  1LQQ A;  1SNB A;  3KHW A;  1P0A A;  1PTX A;  2GMO A;  1I2U A;  2KPY A;  3GL1 A;  1POI A;  3D2E A;  3QFP A;  2E0H A;  5FPD A;  1BRZ A;  1L4V A;  2LY5 A;  2QWP A;  1JKZ A;  1NGJ A;  3LDO A;  3D2F B;  1LQH A;  3QI7 A;  4FL9 A;  1ZYV A;  2ATB A;  3L4I A;  2BUP A;  1ZYW A;  3KOY A;  1NGE A;  1QQO A;  1SEG A;  2KGQ A;  2QWN A;  1C55 A;  1FH3 A;  1NH5 A;  2YIO A;  1ZVE A;  1KAX A;  5AQM A;  5AQS A;  2QWQ A;  2M8B B;  5FPM A;  3A8Y A;  3KVG A;  3FZH A;  5AQN A;  5BN9 A;  1NGB A;  3PSM A;  1NGA A;  5AQX A;  2MZ0 A;  5AQW A;  1WT7 A;  1KV0 A;  2E3F A;  3CQX A;  3D2E B;  3R2V A;  4H5T A;  5AQU A;  3SF4 D;  5F0X A;  3KP1 A;  5AR0 A;  1VNB A;  5F2R A;  4KBO A;  1BUP A;  2K35 A;  2QXL A;  1T0Z A;  4UAE F;  1S3X A;  5BPL A;  1B3C A;  5AQO A;  1JZB A;  2N2R A;  3FZK A;  3KOZ A;  2SN3 A;  3M3Z A;  5AQZ A;  2KJA A;  1CN2 A;  1NGH A;  5AQT A;  4H5W A;  1BK8 A;  1MYN A;  2E3G A;  1WMT A;  2KHO A;  2N2Q A;  2N69 A;  1LQI A;  1XRS B;  2V7Z A;  5AQV A;  5FPE A;  1QQN A;  2KBK A;  2LT8 A;  3FZF A;  3CW4 A;  2LR3 A;  1ATR A;  2LJM A;  1NE5 A;  3GKU A;  5BPN A;  5AQR A;  4IO8 A;  1C56 A;  2LY6 A;  2D56 A;  1NGD A;  4CQK A;  1HX1 A;  1PX9 A;  3FZL A;  3LDN A;  2YEO A;  2E2F A;  3I33 A;  3L56 A;  5FPN A;  5BPM A;  1SN1 A;  1GPS A;  1ICA A;  1I2V A;  5AQJ A;  2QWM A;  3C7N A;  2G2K A;  2YC1 C;  4H5V A;  1ZVG A;  4H5R A;  4HWI A;  1HJO A;  1GPT A;  5AQQ A;  5AQP A;  1I6G A;  1KAZ A;  2JDQ D;  3D2F A;  2E88 A;  1NRA A;  1ZFU A;  4HHF A;  1JZA A;  2NY9 X;  4FSV A;  1NPI A;  2BRZ A;  5AQK A;  1WWN A;  1CHZ A;  3BK3 C;  3GDQ A;  1PE4 A;  2LKB A;  3KOX A;  2LI7 A;  1BA1 A;  2QW9 A;  1TI5 A;  2KSK A;  5F1X A;  2YIP A;  3HSC A;  3FZM A;  3L6Q A;  4GNI A;  1NGG A;  2LN8 A;  1BCG A;  2B3C A;  2I61 A;  4UJ0 A;  2A7T A;  1NGI A;  5AQG A;  1JXC A;  2KBH A;  2MN5 A;  5EX5 A;  2ASC A;  2NY8 X;  2KBJ A;  2E8A A;  3E7U X;  5AQF A;  5EY4 A;  1OMY A;  5AQH A;  3IUC A;  1I6F A;  3QML A;  2MBK A;  5KK4 A;  1ATS A;  1SN4 A;  4UAF E;  1BMR A;  1YUW A;  5AQY A;  1BA0 A;  1DJT A;  1ZU3 A;  1DQ7 A;  2QWR A;  5AQL A;  2N66 A;  1NGF A;  3FE1 A;  1KAY A;  2QWO A;  4AAZ A;  1T7A A;  3ATU A;  4V1D C;  3LDP A;  5EVZ A;  4KYP A;  1N4N A;  3KOW A;  4H5N A;  5BN8 A;  1NGC A;  3KC6 A;  3LDQ A;  1ZUT A;  2YIL A;  3C7N B;  5AQI A;  5EXW A;  3AY9 A;  1MR4 A;  1T1T A;  3JXU A;  4UAD E;  3ATV A;  1NRB A;  1UGL A;  3E7R L;  1B7D A;  1VNA A;  1P00 A;  2QWL A;  1OZZ A;  1K8B A;  1DKG D;  1T7E A;  2YBR C;  1QQM A;  2B68 A;  2LJ7 A;  2GL1 A;  2VY6 A; 
#chains in the Genus database with same CATH homology
 4AEI A;  1AYJ A;  4AB0 A;  5CY0 A;  1AHO A;  4HE7 A;  1T7B A;  2KYQ A;  1LQQ A;  1SNB A;  1P0A A;  1PTX A;  1I2U A;  2KPY A;  1BRZ A;  1L4V A;  2E0H A;  2LY5 A;  1JKZ A;  1LQH A;  1ZYV A;  2ATB A;  1ZYW A;  2KGQ A;  1SEG A;  1C55 A;  1FH3 A;  1NH5 A;  1ZVE A;  2M8B B;  3PSM A;  2MZ0 A;  1WT7 A;  2E3F A;  1KV0 A;  1VNB A;  1B3C A;  1T0Z A;  1JZB A;  2N2R A;  2SN3 A;  2KJA A;  1CN2 A;  1BK8 A;  1MYN A;  2E3G A;  1WMT A;  2N2Q A;  2N69 A;  1LQI A;  2KBK A;  2LT8 A;  2LR3 A;  2LJM A;  1NE5 A;  1C56 A;  2LY6 A;  4CQK A;  1PX9 A;  2YEO A;  1GPS A;  1ICA A;  1SN1 A;  1I2V A;  2YC1 C;  1ZVG A;  1GPT A;  1I6G A;  1NRA A;  1ZFU A;  4HHF A;  1JZA A;  2NY9 X;  1NPI A;  2BRZ A;  1WWN A;  1CHZ A;  1PE4 A;  2LKB A;  2LI7 A;  1TI5 A;  2KSK A;  1BCG A;  2B3C A;  2I61 A;  4UJ0 A;  2A7T A;  1JXC A;  2KBH A;  2ASC A;  2NY8 X;  2KBJ A;  3E7U X;  1OMY A;  1I6F A;  5KK4 A;  1SN4 A;  1BMR A;  1ZU3 A;  1DJT A;  1DQ7 A;  2N66 A;  4AAZ A;  1T7A A;  4V1D C;  4KYP A;  1N4N A;  1ZUT A;  1MR4 A;  1T1T A;  1NRB A;  3E7R L;  1B7D A;  1VNA A;  1P00 A;  1OZZ A;  1T7E A;  2YBR C;  2B68 A;  2LJ7 A;  2GL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...