1BK8A

Determination of the three-dimensional solution structure of aesculus hippocastanum antimicrobial protein 1 (ah-amp1) by 1h nmr, 25 structures
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
50
structure length
50
Chain Sequence
LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant defensin
molecule keywords ANTIMICROBIAL PROTEIN 1
publication title The three-dimensional solution structure of Aesculus hippocastanum antimicrobial protein 1 determined by 1H nuclear magnetic resonance.
pubmed doi rcsb
total genus 15
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1998-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1bk8A00
1SEGA 1BCGA 1SN1A 1JKZA 1I2UA 1MYNA 1C55A 2M8BB 1JZAA 1TI5A 1L4VA 1LQIA 1T7EA 1CN2A 1VNBA 1PE4A 4HE7A 2SN3A 1B3CA 1GPSA 2LR3A 2ATBA 2LY6A 2LI7A 1BRZA 1JXCA 2A7TA 1PX9A 2LJ7A 1SN4A 1ZFUA 1I6GA 1NPIA 5KK4A 1BMRA 1N4NA 1T7AA 4AAZA 1PTXA 1C56A 1FH3A 2E3FA 1VNAA 2NY9X 2KBKA 2E3GA 1KV0A 1I2VA 2NY8X 1NH5A 4CQKA 2YC1C 2N2RA 1ZVEA 1LQHA 2LT8A 1MR4A 1OZZA 1ZVGA 1CHZA 1B7DA 2N66A 1WMTA 1ZYVA 1WWNA 2ASCA 3E7RL 1AYJA 4AB0A 2GL1A 2LKBA 1T1TA 2N2QA 1ZU3A 4HHFA 1P00A 1T0ZA 1NE5A 1I6FA 1DJTA 1SNBA 2KGQA 2YBRC 3E7UX 1ZYWA 4V1DC 4AEIA 1NRAA 1GPTA 2KBJA 1P0AA 1OMYA 2KPYA 3PSMA 2B68A 2N69A 1BK8A 2B3CA 2KYQA 1WT7A 2E0HA 4KYPA 2I61A 2YEOA 2KBHA 1ICAA 2KSKA 1T7BA 1LQQA 4UJ0A 2KJAA 5CY0A 1DQ7A 1ZUTA 1NRBA 1AHOA 2MZ0A 1JZBA 2LJMA 2BRZA 2LY5A
chains in the Genus database with same CATH superfamily
1SEGA 1BCGA 3KHWA 5AQZA 1SN1A 3CQXA 1JKZA 3D2EA 1I2UA 1MYNA 2QWMA 1HX1A 1C55A 2M8BB 3GKUA 1JZAA 3BK3C 1TI5A 5BN9A 1L4VA 1LQIA 4UAFE 3LDNA 3L6QA 2JDQD 2E8AA 1NGDA 1T7EA 1CN2A 1NGCA 1VNBA 1PE4A 3CW4A 4HE7A 2LN8A 2SN3A 4HWIA 1B3CA 1GPSA 1QQMA 2LR3A 2ATBA 1S3XA 3D2EB 5BPNA 2LY6A 2LI7A 1NGBA 2QWNA 1ATRA 2MBKA 1BRZA 2D56A 2QWPA 1JXCA 3FZKA 2A7TA 3GL1A 4H5VA 5BPMA 1PX9A 3KOYA 3L56A 1KAYA 5AQGA 2LJ7A 5EXWA 1QQNA 3QI7A 1SN4A 5F1XA 1K8BA 1UGLA 1ZFUA 1I6GA 3ATUA 5AQTA 2E88A 1NPIA 5AQQA 1HJOA 5KK4A 5AQOA 5EVZA 3KP1A 1BMRA 1HPMA 1N4NA 1T7AA 2KHOA 4FL9A 2BUPA 5AQHA 5AR0A 5FPNA 1PTXA 1C56A 4AAZA 2E3FA 1FH3A 5AQIA 1BA0A 1VNAA 2MN5A 3A8YA 2QWLA 3KOXA 2NY9X 3I33A 2KBKA 5AQMA 1BUPA 5EY4A 3SF4D 1QQOA 3KC6A 2E3GA 5FPMA 1KV0A 1I2VA 2QWRA 3LDOA 3LDQA 2NY8X 1NH5A 2YIOA 3IUCA 4CQKA 2QXLA 2YC1C 2GMOA 2N2RA 5AQLA 2VY6A 1ZVEA 1LQHA 2K35A 2LT8A 1MR4A 5AQRA 4H5NA 1OZZA 3LDPA 3D2FA 1CHZA 1ZVGA 1B7DA 1DKGD 3R2VA 5AQFA 2N66A 5AQKA 5AQWA 1WMTA 4UADE 1ZYVA 1BA1A 1WWNA 3FZMA 1KAZA 3FZLA 3JXUA 4KBOA 5FPEA 2ASCA 5AQVA 3E7RL 3ATVA 2E2FA 3KOZA 1AYJA 1NGJA 3GDQA 5EX5A 4AB0A 2GL1A 5AQYA 2LKBA 4H5TA 1ATSA 1T1TA 2N2QA 2V7ZA 3KOWA 1ZU3A 3D2FB 4HHFA 1YUWA 1P00A 1T0ZA 4H5RA 1NE5A 1I6FA 3C7NA 1DJTA 1SNBA 2KGQA 2G2KA 1NGFA 3AY9A 3QFUA 2YBRC 3E7UX 4IO8A 1NGEA 3M3ZA 5AQSA 5AQXA 1ZYWA 4V1DC 4AEIA 1NRAA 1GPTA 2KBJA 1P0AA 1OMYA 3FZFA 2KPYA 3PSMA 5BN8A 1NGHA 2B68A 2N69A 1KAXA 1BK8A 3C7NB 2B3CA 2KYQA 2QWQA 3KP0A 1WT7A 1XRSB 5BPLA 5AQJA 5FPDA 3QFPA 2QWOA 2E0HA 3KVGA 3LDLA 4KYPA 2I61A 2YEOA 1NGIA 2KBHA 4H5WA 1POIA 1T7BA 2KSKA 5F0XA 1ICAA 1LQQA 4FSVA 5AQNA 4UJ0A 2YIPA 2KJAA 5CY0A 1DQ7A 3FE1A 1ZUTA 1NRBA 1AHOA 4GNIA 5AQUA 2MZ0A 1NGGA 2QW9A 3L4IA 3QMLA 3HSCA 5AQPA 1JZBA 1NGAA 3FZHA 4UAEF 2LJMA 2BRZA 2YILA 5F2RA 2LY5A
chains in the Genus database with same CATH topology
1SEGA 1BCGA 1SN1A 1JKZA 1I2UA 1MYNA 1C55A 2M8BB 1JZAA 1TI5A 1L4VA 1LQIA 1T7EA 1CN2A 1VNBA 1PE4A 4HE7A 2SN3A 1B3CA 1GPSA 2LR3A 2ATBA 2LY6A 2LI7A 1BRZA 1JXCA 2A7TA 1PX9A 2LJ7A 1SN4A 1ZFUA 1I6GA 1NPIA 5KK4A 1BMRA 1N4NA 1T7AA 4AAZA 1PTXA 1C56A 1FH3A 2E3FA 1VNAA 2NY9X 2KBKA 2E3GA 1KV0A 1I2VA 2NY8X 1NH5A 4CQKA 2YC1C 2N2RA 1ZVEA 1LQHA 2LT8A 1MR4A 1OZZA 1ZVGA 1CHZA 1B7DA 2N66A 1WMTA 1ZYVA 1WWNA 2ASCA 3E7RL 1AYJA 4AB0A 2GL1A 2LKBA 1T1TA 2N2QA 1ZU3A 4HHFA 1P00A 1T0ZA 1NE5A 1I6FA 1DJTA 1SNBA 2KGQA 2YBRC 3E7UX 1ZYWA 4V1DC 4AEIA 1NRAA 1GPTA 2KBJA 1P0AA 1OMYA 2KPYA 3PSMA 2B68A 2N69A 1BK8A 2B3CA 2KYQA 1WT7A 2E0HA 4KYPA 2I61A 2YEOA 2KBHA 1ICAA 2KSKA 1T7BA 1LQQA 4UJ0A 2KJAA 5CY0A 1DQ7A 1ZUTA 1NRBA 1AHOA 2MZ0A 1JZBA 2LJMA 2BRZA 2LY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SEG A;  1BCG A;  1SN1 A;  1JKZ A;  1I2U A;  1MYN A;  1C55 A;  2M8B B;  1JZA A;  1TI5 A;  1L4V A;  1LQI A;  1T7E A;  1CN2 A;  1VNB A;  1PE4 A;  4HE7 A;  2SN3 A;  1B3C A;  1GPS A;  2LR3 A;  2ATB A;  2LY6 A;  2LI7 A;  1BRZ A;  1JXC A;  2A7T A;  1PX9 A;  2LJ7 A;  1SN4 A;  1ZFU A;  1I6G A;  1NPI A;  5KK4 A;  1BMR A;  1N4N A;  1T7A A;  4AAZ A;  1PTX A;  1C56 A;  1FH3 A;  2E3F A;  1VNA A;  2NY9 X;  2KBK A;  2E3G A;  1KV0 A;  1I2V A;  2NY8 X;  1NH5 A;  4CQK A;  2YC1 C;  2N2R A;  1ZVE A;  1LQH A;  2LT8 A;  1MR4 A;  1OZZ A;  1ZVG A;  1CHZ A;  1B7D A;  2N66 A;  1WMT A;  1ZYV A;  1WWN A;  2ASC A;  3E7R L;  1AYJ A;  4AB0 A;  2GL1 A;  2LKB A;  1T1T A;  2N2Q A;  1ZU3 A;  4HHF A;  1P00 A;  1T0Z A;  1NE5 A;  1I6F A;  1DJT A;  1SNB A;  2KGQ A;  2YBR C;  3E7U X;  1ZYW A;  4V1D C;  4AEI A;  1NRA A;  1GPT A;  2KBJ A;  1P0A A;  1OMY A;  2KPY A;  3PSM A;  2B68 A;  2N69 A;  1BK8 A;  2B3C A;  2KYQ A;  1WT7 A;  2E0H A;  4KYP A;  2I61 A;  2YEO A;  2KBH A;  1ICA A;  2KSK A;  1T7B A;  1LQQ A;  4UJ0 A;  2KJA A;  5CY0 A;  1DQ7 A;  1ZUT A;  1NRB A;  1AHO A;  2MZ0 A;  1JZB A;  2LJM A;  2BRZ A;  2LY5 A; 
#chains in the Genus database with same CATH topology
 1SEG A;  1BCG A;  3KHW A;  5AQZ A;  1SN1 A;  3CQX A;  1JKZ A;  3D2E A;  1I2U A;  1MYN A;  2QWM A;  1HX1 A;  1C55 A;  2M8B B;  3GKU A;  1JZA A;  3BK3 C;  1TI5 A;  5BN9 A;  1L4V A;  1LQI A;  4UAF E;  3LDN A;  3L6Q A;  2JDQ D;  2E8A A;  1NGD A;  1T7E A;  1CN2 A;  1NGC A;  1VNB A;  1PE4 A;  3CW4 A;  4HE7 A;  2LN8 A;  2SN3 A;  4HWI A;  1B3C A;  1GPS A;  1QQM A;  2LR3 A;  2ATB A;  1S3X A;  3D2E B;  5BPN A;  2LY6 A;  2LI7 A;  1NGB A;  2QWN A;  1ATR A;  2MBK A;  1BRZ A;  2D56 A;  2QWP A;  1JXC A;  3FZK A;  2A7T A;  3GL1 A;  4H5V A;  5BPM A;  1PX9 A;  3KOY A;  3L56 A;  1KAY A;  5AQG A;  2LJ7 A;  5EXW A;  1QQN A;  3QI7 A;  1SN4 A;  5F1X A;  1K8B A;  1UGL A;  1ZFU A;  1I6G A;  3ATU A;  5AQT A;  2E88 A;  1NPI A;  5AQQ A;  1HJO A;  5KK4 A;  5AQO A;  5EVZ A;  3KP1 A;  1BMR A;  1HPM A;  1N4N A;  1T7A A;  2KHO A;  4FL9 A;  2BUP A;  5AQH A;  5AR0 A;  5FPN A;  1PTX A;  1C56 A;  4AAZ A;  2E3F A;  1FH3 A;  5AQI A;  1BA0 A;  1VNA A;  2MN5 A;  3A8Y A;  2QWL A;  3KOX A;  2NY9 X;  3I33 A;  2KBK A;  5AQM A;  1BUP A;  5EY4 A;  3SF4 D;  1QQO A;  3KC6 A;  2E3G A;  5FPM A;  1KV0 A;  1I2V A;  2QWR A;  3LDO A;  3LDQ A;  2NY8 X;  1NH5 A;  2YIO A;  3IUC A;  4CQK A;  2QXL A;  2YC1 C;  2GMO A;  2N2R A;  5AQL A;  2VY6 A;  1ZVE A;  1LQH A;  2K35 A;  2LT8 A;  1MR4 A;  5AQR A;  4H5N A;  1OZZ A;  3LDP A;  3D2F A;  1CHZ A;  1ZVG A;  1B7D A;  1DKG D;  3R2V A;  5AQF A;  2N66 A;  5AQK A;  5AQW A;  1WMT A;  4UAD E;  1ZYV A;  1BA1 A;  1WWN A;  3FZM A;  1KAZ A;  3FZL A;  3JXU A;  4KBO A;  5FPE A;  2ASC A;  5AQV A;  3E7R L;  3ATV A;  2E2F A;  3KOZ A;  1AYJ A;  1NGJ A;  3GDQ A;  5EX5 A;  4AB0 A;  2GL1 A;  5AQY A;  2LKB A;  4H5T A;  1ATS A;  1T1T A;  2N2Q A;  2V7Z A;  3KOW A;  1ZU3 A;  3D2F B;  4HHF A;  1YUW A;  1P00 A;  1T0Z A;  4H5R A;  1NE5 A;  1I6F A;  3C7N A;  1DJT A;  1SNB A;  2KGQ A;  2G2K A;  1NGF A;  3AY9 A;  3QFU A;  2YBR C;  3E7U X;  4IO8 A;  1NGE A;  3M3Z A;  5AQS A;  5AQX A;  1ZYW A;  4V1D C;  4AEI A;  1NRA A;  1GPT A;  2KBJ A;  1P0A A;  1OMY A;  3FZF A;  2KPY A;  3PSM A;  5BN8 A;  1NGH A;  2B68 A;  2N69 A;  1KAX A;  1BK8 A;  3C7N B;  2B3C A;  2KYQ A;  2QWQ A;  3KP0 A;  1WT7 A;  1XRS B;  5BPL A;  5AQJ A;  5FPD A;  3QFP A;  2QWO A;  2E0H A;  3KVG A;  3LDL A;  4KYP A;  2I61 A;  2YEO A;  1NGI A;  2KBH A;  4H5W A;  1POI A;  1T7B A;  2KSK A;  5F0X A;  1ICA A;  1LQQ A;  4FSV A;  5AQN A;  4UJ0 A;  2YIP A;  2KJA A;  5CY0 A;  1DQ7 A;  3FE1 A;  1ZUT A;  1NRB A;  1AHO A;  4GNI A;  5AQU A;  2MZ0 A;  1NGG A;  2QW9 A;  3L4I A;  3QML A;  3HSC A;  5AQP A;  1JZB A;  1NGA A;  3FZH A;  4UAE F;  2LJM A;  2BRZ A;  2YIL A;  5F2R A;  2LY5 A; 
#chains in the Genus database with same CATH homology
 1SEG A;  1BCG A;  1SN1 A;  1JKZ A;  1I2U A;  1MYN A;  1C55 A;  2M8B B;  1JZA A;  1TI5 A;  1L4V A;  1LQI A;  1T7E A;  1CN2 A;  1VNB A;  1PE4 A;  4HE7 A;  2SN3 A;  1B3C A;  1GPS A;  2LR3 A;  2ATB A;  2LY6 A;  2LI7 A;  1BRZ A;  1JXC A;  2A7T A;  1PX9 A;  2LJ7 A;  1SN4 A;  1ZFU A;  1I6G A;  1NPI A;  5KK4 A;  1BMR A;  1N4N A;  1T7A A;  4AAZ A;  1PTX A;  1C56 A;  1FH3 A;  2E3F A;  1VNA A;  2NY9 X;  2KBK A;  2E3G A;  1KV0 A;  1I2V A;  2NY8 X;  1NH5 A;  4CQK A;  2YC1 C;  2N2R A;  1ZVE A;  1LQH A;  2LT8 A;  1MR4 A;  1OZZ A;  1ZVG A;  1CHZ A;  1B7D A;  2N66 A;  1WMT A;  1ZYV A;  1WWN A;  2ASC A;  3E7R L;  1AYJ A;  4AB0 A;  2GL1 A;  2LKB A;  1T1T A;  2N2Q A;  1ZU3 A;  4HHF A;  1P00 A;  1T0Z A;  1NE5 A;  1I6F A;  1DJT A;  1SNB A;  2KGQ A;  2YBR C;  3E7U X;  1ZYW A;  4V1D C;  4AEI A;  1NRA A;  1GPT A;  2KBJ A;  1P0A A;  1OMY A;  2KPY A;  3PSM A;  2B68 A;  2N69 A;  1BK8 A;  2B3C A;  2KYQ A;  1WT7 A;  2E0H A;  4KYP A;  2I61 A;  2YEO A;  2KBH A;  1ICA A;  2KSK A;  1T7B A;  1LQQ A;  4UJ0 A;  2KJA A;  5CY0 A;  1DQ7 A;  1ZUT A;  1NRB A;  1AHO A;  2MZ0 A;  1JZB A;  2LJM A;  2BRZ A;  2LY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...