1BRZA

Solution structure of the sweet protein brazzein, nmr, 43 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
54
structure length
54
Chain Sequence
b'EDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BRAZZEIN
publication title Solution structure of the thermostable sweet-tasting protein brazzein.
pubmed doi rcsb
molecule tags Sweet protein
total genus 7
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1998-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1brzA00
1PE4A 1MYNA 1PTXA 2LY5A 1T1TA 1AHOA 1JKZA 3E7RL 2KSKA 2N66A 1C56A 2KBHA 2ATBA 4AB0A 1CN2A 2LT8A 2YC1C 1VNAA 4V1DC 1ZYWA 1LQHA 1DQ7A 1SNBA 1B3CA 2KBJA 2E3FA 1GPSA 2LKBA 1L4VA 2KGQA 1SN4A 1T7BA 1DJTA 2KPYA 4HHFA 1OMYA 1N4NA 1C55A 5CY0A 1P0AA 2KJAA 1SEGA 1ZVEA 1T7EA 1ZU3A 1JZBA 4AEIA 2LJMA 2N69A 1BMRA 1ZVGA 1ZYVA 4UJ0A 1SN1A 1B7DA 2YEOA 2YBRC 1I2UA 1BK8A 1JZAA 2KBKA 1OZZA 1PX9A 2NY8X 1ICAA 1NRBA 2NY9X 1P00A 1WWNA 1BRZA 2E0HA 1T7AA 1FH3A 2LJ7A 1VNBA 1WMTA 1GPTA 4HE7A 1NH5A 1NRAA 1I2VA 2BRZA 1ZFUA 1JXCA 2I61A 1MR4A 2B3CA 1ZUTA 1NPIA 1BCGA 2N2QA 2LI7A 2A7TA 1LQIA 1CHZA 3PSMA 2LR3A 4CQKA 1KV0A 1NE5A 1WT7A 5KK4A 1TI5A 4AAZA 2ASCA 2KYQA 2E3GA 1I6FA 2MZ0A 2GL1A 2SN3A 3E7UX 1LQQA 1AYJA 4KYPA 1I6GA 1T0ZA 2N2RA 2LY6A 2M8BB 2B68A
chains in the Genus database with same CATH superfamily
1PE4A 3HSCA 5FPNA 1MYNA 5AQQA 1PTXA 2LY5A 1T1TA 5AQVA 1AHOA 3KOWA 5F1XA 3I33A 2G2KA 1HJOA 3CW4A 2QWMA 2KHOA 1JKZA 3E7RL 3KOXA 3LDNA 5F0XA 2KSKA 2N66A 1C56A 2KBHA 4AEIA 2ATBA 4UAEF 5AR0A 4AB0A 1CN2A 2LT8A 2YC1C 1VNAA 1NGJA 1QQOA 4V1DC 1ZYWA 2V7ZA 1LQHA 1DQ7A 3GDQA 1SNBA 3L4IA 5FPDA 1B3CA 2KBJA 4GNIA 5AQYA 2E3FA 1GPSA 3FZKA 4H5RA 3L56A 4H5WA 5F2RA 3LDOA 1BA1A 2VY6A 2LKBA 1L4VA 2KGQA 1SN4A 3R2VA 1T7BA 2GMOA 5BPLA 1DJTA 3KVGA 2KPYA 3FZFA 2QWNA 1BUPA 4HHFA 1OMYA 1NGDA 2MBKA 5AQIA 2E8AA 4FSVA 3KOYA 2QXLA 1N4NA 1C55A 5CY0A 1ATRA 1P0AA 2KJAA 1HPMA 1SEGA 1ZVEA 1T7EA 5BPMA 3FE1A 1ZU3A 1JZBA 4H5NA 3QI7A 3FZLA 1KAXA 1UGLA 3GKUA 3ATVA 2LJMA 2N69A 3GL1A 5AQLA 3LDLA 1BMRA 1S3XA 3C7NA 1ZVGA 1ZYVA 4UJ0A 3FZMA 1DKGD 3D2EA 2BUPA 3QFPA 1SN1A 1B7DA 1NGGA 2YEOA 3LDPA 2YBRC 2QWQA 5AQJA 1BK8A 1JZAA 2KBKA 1QQNA 1I2UA 1OZZA 1PX9A 1QQMA 2NY8X 5AQTA 1ICAA 4IO8A 2D56A 2K35A 1NRBA 5AQNA 2NY9X 1NGHA 1P00A 5EXWA 1WWNA 1BRZA 2E0HA 1T7AA 2MN5A 1FH3A 2LJ7A 5EVZA 1VNBA 2LN8A 5BPNA 1NGEA 5AQZA 1WMTA 4H5VA 4KBOA 1GPTA 1POIA 4HE7A 4H5TA 5AQKA 3LDQA 2QWPA 1NH5A 1NRAA 5AQOA 2QW9A 1I2VA 2BRZA 2YILA 3BK3C 5AQHA 1ZFUA 3C7NB 1JXCA 1NGAA 3KHWA 3M3ZA 5AQFA 3ATUA 3D2FA 2I61A 1MR4A 2B3CA 2E2FA 3D2EB 1ZUTA 3AY9A 3D2FB 1K8BA 3CQXA 3QMLA 1NPIA 2QWOA 1BCGA 3L6QA 3KC6A 2N2QA 2LI7A 5EX5A 5FPMA 2A7TA 1BA0A 1NGIA 2QWLA 5BN8A 3KOZA 5AQUA 5FPEA 1CHZA 1LQIA 3KP1A 2YIOA 3QFUA 3PSMA 1YUWA 2LR3A 4CQKA 5AQMA 1HX1A 1KV0A 1NE5A 3IUCA 2E88A 1WT7A 5KK4A 1TI5A 1KAYA 3A8YA 3SF4D 5AQSA 4AAZA 2ASCA 2KYQA 2JDQD 2E3GA 4HWIA 4UADE 4FL9A 1I6FA 1NGCA 3JXUA 2MZ0A 5BN9A 2GL1A 2SN3A 3E7UX 1KAZA 1LQQA 4UAFE 5AQWA 5AQPA 1AYJA 4KYPA 1I6GA 2YIPA 1NGBA 2QWRA 1T0ZA 3FZHA 2N2RA 5AQXA 1NGFA 1XRSB 3KP0A 5EY4A 1ATSA 5AQGA 2LY6A 2M8BB 5AQRA 2B68A
chains in the Genus database with same CATH topology
1PE4A 1MYNA 1PTXA 2LY5A 1T1TA 1AHOA 1JKZA 3E7RL 2KSKA 2N66A 1C56A 2KBHA 2ATBA 4AB0A 1CN2A 2LT8A 2YC1C 1VNAA 4V1DC 1ZYWA 1LQHA 1DQ7A 1SNBA 1B3CA 2KBJA 2E3FA 1GPSA 2LKBA 1L4VA 2KGQA 1SN4A 1T7BA 1DJTA 2KPYA 4HHFA 1OMYA 1N4NA 1C55A 5CY0A 1P0AA 2KJAA 1SEGA 1ZVEA 1T7EA 1ZU3A 1JZBA 4AEIA 2LJMA 2N69A 1BMRA 1ZVGA 1ZYVA 4UJ0A 1SN1A 1B7DA 2YEOA 2YBRC 1I2UA 1BK8A 1JZAA 2KBKA 1OZZA 1PX9A 2NY8X 1ICAA 1NRBA 2NY9X 1P00A 1WWNA 1BRZA 2E0HA 1T7AA 1FH3A 2LJ7A 1VNBA 1WMTA 1GPTA 4HE7A 1NH5A 1NRAA 1I2VA 2BRZA 1ZFUA 1JXCA 2I61A 1MR4A 2B3CA 1ZUTA 1NPIA 1BCGA 2N2QA 2LI7A 2A7TA 1LQIA 1CHZA 3PSMA 2LR3A 4CQKA 1KV0A 1NE5A 1WT7A 5KK4A 1TI5A 4AAZA 2ASCA 2KYQA 2E3GA 1I6FA 2MZ0A 2GL1A 2SN3A 3E7UX 1LQQA 1AYJA 4KYPA 1I6GA 1T0ZA 2N2RA 2LY6A 2M8BB 2B68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PE4 A;  1MYN A;  1PTX A;  2LY5 A;  1T1T A;  1AHO A;  1JKZ A;  3E7R L;  2KSK A;  2N66 A;  1C56 A;  2KBH A;  2ATB A;  4AB0 A;  1CN2 A;  2LT8 A;  2YC1 C;  1VNA A;  4V1D C;  1ZYW A;  1LQH A;  1DQ7 A;  1SNB A;  1B3C A;  2KBJ A;  2E3F A;  1GPS A;  2LKB A;  1L4V A;  2KGQ A;  1SN4 A;  1T7B A;  1DJT A;  2KPY A;  4HHF A;  1OMY A;  1N4N A;  1C55 A;  5CY0 A;  1P0A A;  2KJA A;  1SEG A;  1ZVE A;  1T7E A;  1ZU3 A;  1JZB A;  4AEI A;  2LJM A;  2N69 A;  1BMR A;  1ZVG A;  1ZYV A;  4UJ0 A;  1SN1 A;  1B7D A;  2YEO A;  2YBR C;  1I2U A;  1BK8 A;  1JZA A;  2KBK A;  1OZZ A;  1PX9 A;  2NY8 X;  1ICA A;  1NRB A;  2NY9 X;  1P00 A;  1WWN A;  1BRZ A;  2E0H A;  1T7A A;  1FH3 A;  2LJ7 A;  1VNB A;  1WMT A;  1GPT A;  4HE7 A;  1NH5 A;  1NRA A;  1I2V A;  2BRZ A;  1ZFU A;  1JXC A;  2I61 A;  1MR4 A;  2B3C A;  1ZUT A;  1NPI A;  1BCG A;  2N2Q A;  2LI7 A;  2A7T A;  1LQI A;  1CHZ A;  3PSM A;  2LR3 A;  4CQK A;  1KV0 A;  1NE5 A;  1WT7 A;  5KK4 A;  1TI5 A;  4AAZ A;  2ASC A;  2KYQ A;  2E3G A;  1I6F A;  2MZ0 A;  2GL1 A;  2SN3 A;  3E7U X;  1LQQ A;  1AYJ A;  4KYP A;  1I6G A;  1T0Z A;  2N2R A;  2LY6 A;  2M8B B;  2B68 A; 
#chains in the Genus database with same CATH topology
 1PE4 A;  3HSC A;  5FPN A;  1MYN A;  5AQQ A;  1PTX A;  2LY5 A;  1T1T A;  5AQV A;  1AHO A;  3KOW A;  5F1X A;  3I33 A;  2G2K A;  1HJO A;  3CW4 A;  2QWM A;  2KHO A;  1JKZ A;  3E7R L;  3KOX A;  3LDN A;  5F0X A;  2KSK A;  2N66 A;  1C56 A;  2KBH A;  4AEI A;  2ATB A;  4UAE F;  5AR0 A;  4AB0 A;  1CN2 A;  2LT8 A;  2YC1 C;  1VNA A;  1NGJ A;  1QQO A;  4V1D C;  1ZYW A;  2V7Z A;  1LQH A;  1DQ7 A;  3GDQ A;  1SNB A;  3L4I A;  5FPD A;  1B3C A;  2KBJ A;  4GNI A;  5AQY A;  2E3F A;  1GPS A;  3FZK A;  4H5R A;  3L56 A;  4H5W A;  5F2R A;  3LDO A;  1BA1 A;  2VY6 A;  2LKB A;  1L4V A;  2KGQ A;  1SN4 A;  3R2V A;  1T7B A;  2GMO A;  5BPL A;  1DJT A;  3KVG A;  2KPY A;  3FZF A;  2QWN A;  1BUP A;  4HHF A;  1OMY A;  1NGD A;  2MBK A;  5AQI A;  2E8A A;  4FSV A;  3KOY A;  2QXL A;  1N4N A;  1C55 A;  5CY0 A;  1ATR A;  1P0A A;  2KJA A;  1HPM A;  1SEG A;  1ZVE A;  1T7E A;  5BPM A;  3FE1 A;  1ZU3 A;  1JZB A;  4H5N A;  3QI7 A;  3FZL A;  1KAX A;  1UGL A;  3GKU A;  3ATV A;  2LJM A;  2N69 A;  3GL1 A;  5AQL A;  3LDL A;  1BMR A;  1S3X A;  3C7N A;  1ZVG A;  1ZYV A;  4UJ0 A;  3FZM A;  1DKG D;  3D2E A;  2BUP A;  3QFP A;  1SN1 A;  1B7D A;  1NGG A;  2YEO A;  3LDP A;  2YBR C;  2QWQ A;  5AQJ A;  1BK8 A;  1JZA A;  2KBK A;  1QQN A;  1I2U A;  1OZZ A;  1PX9 A;  1QQM A;  2NY8 X;  5AQT A;  1ICA A;  4IO8 A;  2D56 A;  2K35 A;  1NRB A;  5AQN A;  2NY9 X;  1NGH A;  1P00 A;  5EXW A;  1WWN A;  1BRZ A;  2E0H A;  1T7A A;  2MN5 A;  1FH3 A;  2LJ7 A;  5EVZ A;  1VNB A;  2LN8 A;  5BPN A;  1NGE A;  5AQZ A;  1WMT A;  4H5V A;  4KBO A;  1GPT A;  1POI A;  4HE7 A;  4H5T A;  5AQK A;  3LDQ A;  2QWP A;  1NH5 A;  1NRA A;  5AQO A;  2QW9 A;  1I2V A;  2BRZ A;  2YIL A;  3BK3 C;  5AQH A;  1ZFU A;  3C7N B;  1JXC A;  1NGA A;  3KHW A;  3M3Z A;  5AQF A;  3ATU A;  3D2F A;  2I61 A;  1MR4 A;  2B3C A;  2E2F A;  3D2E B;  1ZUT A;  3AY9 A;  3D2F B;  1K8B A;  3CQX A;  3QML A;  1NPI A;  2QWO A;  1BCG A;  3L6Q A;  3KC6 A;  2N2Q A;  2LI7 A;  5EX5 A;  5FPM A;  2A7T A;  1BA0 A;  1NGI A;  2QWL A;  5BN8 A;  3KOZ A;  5AQU A;  5FPE A;  1CHZ A;  1LQI A;  3KP1 A;  2YIO A;  3QFU A;  3PSM A;  1YUW A;  2LR3 A;  4CQK A;  5AQM A;  1HX1 A;  1KV0 A;  1NE5 A;  3IUC A;  2E88 A;  1WT7 A;  5KK4 A;  1TI5 A;  1KAY A;  3A8Y A;  3SF4 D;  5AQS A;  4AAZ A;  2ASC A;  2KYQ A;  2JDQ D;  2E3G A;  4HWI A;  4UAD E;  4FL9 A;  1I6F A;  1NGC A;  3JXU A;  2MZ0 A;  5BN9 A;  2GL1 A;  2SN3 A;  3E7U X;  1KAZ A;  1LQQ A;  4UAF E;  5AQW A;  5AQP A;  1AYJ A;  4KYP A;  1I6G A;  2YIP A;  1NGB A;  2QWR A;  1T0Z A;  3FZH A;  2N2R A;  5AQX A;  1NGF A;  1XRS B;  3KP0 A;  5EY4 A;  1ATS A;  5AQG A;  2LY6 A;  2M8B B;  5AQR A;  2B68 A; 
#chains in the Genus database with same CATH homology
 1PE4 A;  1MYN A;  1PTX A;  2LY5 A;  1T1T A;  1AHO A;  1JKZ A;  3E7R L;  2KSK A;  2N66 A;  1C56 A;  2KBH A;  2ATB A;  4AB0 A;  1CN2 A;  2LT8 A;  2YC1 C;  1VNA A;  4V1D C;  1ZYW A;  1LQH A;  1DQ7 A;  1SNB A;  1B3C A;  2KBJ A;  2E3F A;  1GPS A;  2LKB A;  1L4V A;  2KGQ A;  1SN4 A;  1T7B A;  1DJT A;  2KPY A;  4HHF A;  1OMY A;  1N4N A;  1C55 A;  5CY0 A;  1P0A A;  2KJA A;  1SEG A;  1ZVE A;  1T7E A;  1ZU3 A;  1JZB A;  4AEI A;  2LJM A;  2N69 A;  1BMR A;  1ZVG A;  1ZYV A;  4UJ0 A;  1SN1 A;  1B7D A;  2YEO A;  2YBR C;  1I2U A;  1BK8 A;  1JZA A;  2KBK A;  1OZZ A;  1PX9 A;  2NY8 X;  1ICA A;  1NRB A;  2NY9 X;  1P00 A;  1WWN A;  1BRZ A;  2E0H A;  1T7A A;  1FH3 A;  2LJ7 A;  1VNB A;  1WMT A;  1GPT A;  4HE7 A;  1NH5 A;  1NRA A;  1I2V A;  2BRZ A;  1ZFU A;  1JXC A;  2I61 A;  1MR4 A;  2B3C A;  1ZUT A;  1NPI A;  1BCG A;  2N2Q A;  2LI7 A;  2A7T A;  1LQI A;  1CHZ A;  3PSM A;  2LR3 A;  4CQK A;  1KV0 A;  1NE5 A;  1WT7 A;  5KK4 A;  1TI5 A;  4AAZ A;  2ASC A;  2KYQ A;  2E3G A;  1I6F A;  2MZ0 A;  2GL1 A;  2SN3 A;  3E7U X;  1LQQ A;  1AYJ A;  4KYP A;  1I6G A;  1T0Z A;  2N2R A;  2LY6 A;  2M8B B;  2B68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...