1BRZA

Solution structure of the sweet protein brazzein, nmr, 43 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
54
structure length
54
Chain Sequence
EDKCKKVYENYPVSKCQLANQCNYDCKLDKHARSGECFYDEKRNLQCICDYCEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sweet protein
molecule keywords BRAZZEIN
publication title Solution structure of the thermostable sweet-tasting protein brazzein.
pubmed doi rcsb
total genus 7
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1998-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1brzA00
1P0AA 1NPIA 1ZFUA 2N69A 1BRZA 2N2RA 4HE7A 2KPYA 4AB0A 1GPTA 2I61A 4KYPA 1ICAA 1GPSA 1ZYWA 1AHOA 4HHFA 1ZYVA 1B3CA 4V1DC 2ATBA 1SEGA 1WT7A 2N2QA 4AEIA 1SNBA 1I2VA 2KJAA 1VNBA 1SN1A 2BRZA 1NH5A 1NRBA 1WWNA 3PSMA 1PX9A 4CQKA 2KSKA 1C56A 1CN2A 1JZAA 2LT8A 1T7EA 5CY0A 2YC1C 1CHZA 1I6FA 1MR4A 2KBHA 2E3GA 2NY8X 1JXCA 2KBKA 2LJ7A 1ZVGA 1T7AA 1AYJA 2E0HA 1OMYA 1WMTA 2KGQA 1NRAA 1BMRA 1DQ7A 3E7RL 1JKZA 2KYQA 4AAZA 4UJ0A 1BK8A 1PE4A 1LQHA 2LI7A 2A7TA 1I6GA 2LY5A 1LQIA 1P00A 1PTXA 1JZBA 2B68A 1N4NA 1FH3A 1T0ZA 1LQQA 2M8BB 2YBRC 2LR3A 2LJMA 1NE5A 1BCGA 1SN4A 1ZVEA 2SN3A 1DJTA 1TI5A 2GL1A 3E7UX 1ZU3A 1C55A 1I2UA 1VNAA 2LKBA 1T7BA 2E3FA 2KBJA 1L4VA 1T1TA 5KK4A 2ASCA 2LY6A 1B7DA 2N66A 2YEOA 2MZ0A 1MYNA 1KV0A 2B3CA 1OZZA 2NY9X 1ZUTA
chains in the Genus database with same CATH superfamily
5BN9A 1P0AA 1NPIA 3LDPA 2QXLA 3D2EB 4KBOA 1ZFUA 2N69A 3FZHA 5EXWA 5AQZA 1BRZA 3I33A 2N2RA 4HE7A 3FZFA 3L56A 3L6QA 2KPYA 4AB0A 1NGCA 2LN8A 1GPTA 1NGGA 2I61A 5AQIA 5AQHA 1BA1A 2QWLA 4KYPA 3IUCA 2MBKA 3D2FA 3LDLA 1ICAA 4GNIA 1GPSA 1ZYWA 5F2RA 1AHOA 3C7NA 3FZKA 3KOXA 4HHFA 2E8AA 4IO8A 3D2EA 3KP0A 4HWIA 5AQNA 3FZLA 5AQLA 5EVZA 4H5WA 5FPEA 1ZYVA 3KP1A 1B3CA 2QWNA 4V1DC 2ATBA 1SEGA 1WT7A 4FSVA 4UADE 5AQYA 1QQMA 2N2QA 3KC6A 2QWQA 3CQXA 5EY4A 1DKGD 3R2VA 4AEIA 3FZMA 1SNBA 5BN8A 1I2VA 2KJAA 1QQNA 1VNBA 1SN1A 2BRZA 1YUWA 1NH5A 3M3ZA 1NRBA 1WWNA 3PSMA 1PX9A 4CQKA 2KSKA 1C56A 2QWPA 3LDQA 5AR0A 3LDNA 1CN2A 1JZAA 2LT8A 3SF4D 1S3XA 3KOYA 1T7EA 5CY0A 2JDQD 3QFPA 2YC1C 1CHZA 3BK3C 3FE1A 5AQJA 5AQXA 1I6FA 1MR4A 3HSCA 2KBHA 3GDQA 1UGLA 2E2FA 2E3GA 3JXUA 2NY8X 1JXCA 1NGBA 3QI7A 5AQTA 1POIA 2KBKA 5BPNA 2MN5A 3GL1A 5AQKA 2LJ7A 2K35A 1NGIA 1ZVGA 1T7AA 4H5RA 2E88A 1AYJA 2YIPA 2E0HA 1OMYA 1WMTA 2BUPA 2KGQA 1NRAA 3KHWA 3KOWA 2QW9A 5AQWA 1JKZA 5AQMA 1BMRA 1DQ7A 2QWRA 3E7RL 5AQOA 2KYQA 3AY9A 3GKUA 5FPMA 5AQPA 4AAZA 4UJ0A 1BK8A 1KAYA 1PE4A 1LQHA 2LI7A 1ATSA 2A7TA 5BPLA 1I6GA 3ATUA 2LY5A 3LDOA 1NGJA 1KAZA 1LQIA 5F1XA 1NGAA 1HX1A 5EX5A 1P00A 3QMLA 1PTXA 3ATVA 1JZBA 2B68A 5F0XA 2GMOA 3KVGA 1N4NA 1FH3A 5AQGA 1T0ZA 1LQQA 1NGHA 2M8BB 1K8BA 2YBRC 4H5TA 2LR3A 4FL9A 1NGEA 1BUPA 1NGDA 1XRSB 1QQOA 2QWOA 4UAFE 3C7NB 2LJMA 3A8YA 1NE5A 1BCGA 4H5NA 5FPNA 1SN4A 3KOZA 5BPMA 1ZVEA 2SN3A 1DJTA 1ATRA 3QFUA 2YILA 1TI5A 2NY9X 1BA0A 2GL1A 3E7UX 5AQQA 3CW4A 3L4IA 1ZU3A 1C55A 1I2UA 2V7ZA 1KAXA 1NGFA 2VY6A 1VNAA 2YIOA 2LKBA 4H5VA 1T7BA 2E3FA 2KBJA 1L4VA 1T1TA 5FPDA 5KK4A 5AQRA 4UAEF 2ASCA 2D56A 2LY6A 5AQSA 1B7DA 2N66A 2YEOA 2MZ0A 5AQUA 5AQFA 1MYNA 2QWMA 1KV0A 2B3CA 2KHOA 3D2FB 1HJOA 5AQVA 1HPMA 1OZZA 2G2KA 1ZUTA
chains in the Genus database with same CATH topology
1P0AA 1NPIA 1ZFUA 2N69A 1BRZA 2N2RA 4HE7A 2KPYA 4AB0A 1GPTA 2I61A 4KYPA 1ICAA 1GPSA 1ZYWA 1AHOA 4HHFA 1ZYVA 1B3CA 4V1DC 2ATBA 1SEGA 1WT7A 2N2QA 4AEIA 1SNBA 1I2VA 2KJAA 1VNBA 1SN1A 2BRZA 1NH5A 1NRBA 1WWNA 3PSMA 1PX9A 4CQKA 2KSKA 1C56A 1CN2A 1JZAA 2LT8A 1T7EA 5CY0A 2YC1C 1CHZA 1I6FA 1MR4A 2KBHA 2E3GA 2NY8X 1JXCA 2KBKA 2LJ7A 1ZVGA 1T7AA 1AYJA 2E0HA 1OMYA 1WMTA 2KGQA 1NRAA 1BMRA 1DQ7A 3E7RL 1JKZA 2KYQA 4AAZA 4UJ0A 1BK8A 1PE4A 1LQHA 2LI7A 2A7TA 1I6GA 2LY5A 1LQIA 1P00A 1PTXA 1JZBA 2B68A 1N4NA 1FH3A 1T0ZA 1LQQA 2M8BB 2YBRC 2LR3A 2LJMA 1NE5A 1BCGA 1SN4A 1ZVEA 2SN3A 1DJTA 1TI5A 2GL1A 3E7UX 1ZU3A 1C55A 1I2UA 1VNAA 2LKBA 1T7BA 2E3FA 2KBJA 1L4VA 1T1TA 5KK4A 2ASCA 2LY6A 1B7DA 2N66A 2YEOA 2MZ0A 1MYNA 1KV0A 2B3CA 1OZZA 2NY9X 1ZUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P0A A;  1NPI A;  1ZFU A;  2N69 A;  1BRZ A;  2N2R A;  4HE7 A;  2KPY A;  4AB0 A;  1GPT A;  2I61 A;  4KYP A;  1ICA A;  1GPS A;  1ZYW A;  1AHO A;  4HHF A;  1ZYV A;  1B3C A;  4V1D C;  2ATB A;  1SEG A;  1WT7 A;  2N2Q A;  4AEI A;  1SNB A;  1I2V A;  2KJA A;  1VNB A;  1SN1 A;  2BRZ A;  1NH5 A;  1NRB A;  1WWN A;  3PSM A;  1PX9 A;  4CQK A;  2KSK A;  1C56 A;  1CN2 A;  1JZA A;  2LT8 A;  1T7E A;  5CY0 A;  2YC1 C;  1CHZ A;  1I6F A;  1MR4 A;  2KBH A;  2E3G A;  2NY8 X;  1JXC A;  2KBK A;  2LJ7 A;  1ZVG A;  1T7A A;  1AYJ A;  2E0H A;  1OMY A;  1WMT A;  2KGQ A;  1NRA A;  1BMR A;  1DQ7 A;  3E7R L;  1JKZ A;  2KYQ A;  4AAZ A;  4UJ0 A;  1BK8 A;  1PE4 A;  1LQH A;  2LI7 A;  2A7T A;  1I6G A;  2LY5 A;  1LQI A;  1P00 A;  1PTX A;  1JZB A;  2B68 A;  1N4N A;  1FH3 A;  1T0Z A;  1LQQ A;  2M8B B;  2YBR C;  2LR3 A;  2LJM A;  1NE5 A;  1BCG A;  1SN4 A;  1ZVE A;  2SN3 A;  1DJT A;  1TI5 A;  2GL1 A;  3E7U X;  1ZU3 A;  1C55 A;  1I2U A;  1VNA A;  2LKB A;  1T7B A;  2E3F A;  2KBJ A;  1L4V A;  1T1T A;  5KK4 A;  2ASC A;  2LY6 A;  1B7D A;  2N66 A;  2YEO A;  2MZ0 A;  1MYN A;  1KV0 A;  2B3C A;  1OZZ A;  2NY9 X;  1ZUT A; 
#chains in the Genus database with same CATH topology
 5BN9 A;  1P0A A;  1NPI A;  3LDP A;  2QXL A;  3D2E B;  4KBO A;  1ZFU A;  2N69 A;  3FZH A;  5EXW A;  5AQZ A;  1BRZ A;  3I33 A;  2N2R A;  4HE7 A;  3FZF A;  3L56 A;  3L6Q A;  2KPY A;  4AB0 A;  1NGC A;  2LN8 A;  1GPT A;  1NGG A;  2I61 A;  5AQI A;  5AQH A;  1BA1 A;  2QWL A;  4KYP A;  3IUC A;  2MBK A;  3D2F A;  3LDL A;  1ICA A;  4GNI A;  1GPS A;  1ZYW A;  5F2R A;  1AHO A;  3C7N A;  3FZK A;  3KOX A;  4HHF A;  2E8A A;  4IO8 A;  3D2E A;  3KP0 A;  4HWI A;  5AQN A;  3FZL A;  5AQL A;  5EVZ A;  4H5W A;  5FPE A;  1ZYV A;  3KP1 A;  1B3C A;  2QWN A;  4V1D C;  2ATB A;  1SEG A;  1WT7 A;  4FSV A;  4UAD E;  5AQY A;  1QQM A;  2N2Q A;  3KC6 A;  2QWQ A;  3CQX A;  5EY4 A;  1DKG D;  3R2V A;  4AEI A;  3FZM A;  1SNB A;  5BN8 A;  1I2V A;  2KJA A;  1QQN A;  1VNB A;  1SN1 A;  2BRZ A;  1YUW A;  1NH5 A;  3M3Z A;  1NRB A;  1WWN A;  3PSM A;  1PX9 A;  4CQK A;  2KSK A;  1C56 A;  2QWP A;  3LDQ A;  5AR0 A;  3LDN A;  1CN2 A;  1JZA A;  2LT8 A;  3SF4 D;  1S3X A;  3KOY A;  1T7E A;  5CY0 A;  2JDQ D;  3QFP A;  2YC1 C;  1CHZ A;  3BK3 C;  3FE1 A;  5AQJ A;  5AQX A;  1I6F A;  1MR4 A;  3HSC A;  2KBH A;  3GDQ A;  1UGL A;  2E2F A;  2E3G A;  3JXU A;  2NY8 X;  1JXC A;  1NGB A;  3QI7 A;  5AQT A;  1POI A;  2KBK A;  5BPN A;  2MN5 A;  3GL1 A;  5AQK A;  2LJ7 A;  2K35 A;  1NGI A;  1ZVG A;  1T7A A;  4H5R A;  2E88 A;  1AYJ A;  2YIP A;  2E0H A;  1OMY A;  1WMT A;  2BUP A;  2KGQ A;  1NRA A;  3KHW A;  3KOW A;  2QW9 A;  5AQW A;  1JKZ A;  5AQM A;  1BMR A;  1DQ7 A;  2QWR A;  3E7R L;  5AQO A;  2KYQ A;  3AY9 A;  3GKU A;  5FPM A;  5AQP A;  4AAZ A;  4UJ0 A;  1BK8 A;  1KAY A;  1PE4 A;  1LQH A;  2LI7 A;  1ATS A;  2A7T A;  5BPL A;  1I6G A;  3ATU A;  2LY5 A;  3LDO A;  1NGJ A;  1KAZ A;  1LQI A;  5F1X A;  1NGA A;  1HX1 A;  5EX5 A;  1P00 A;  3QML A;  1PTX A;  3ATV A;  1JZB A;  2B68 A;  5F0X A;  2GMO A;  3KVG A;  1N4N A;  1FH3 A;  5AQG A;  1T0Z A;  1LQQ A;  1NGH A;  2M8B B;  1K8B A;  2YBR C;  4H5T A;  2LR3 A;  4FL9 A;  1NGE A;  1BUP A;  1NGD A;  1XRS B;  1QQO A;  2QWO A;  4UAF E;  3C7N B;  2LJM A;  3A8Y A;  1NE5 A;  1BCG A;  4H5N A;  5FPN A;  1SN4 A;  3KOZ A;  5BPM A;  1ZVE A;  2SN3 A;  1DJT A;  1ATR A;  3QFU A;  2YIL A;  1TI5 A;  2NY9 X;  1BA0 A;  2GL1 A;  3E7U X;  5AQQ A;  3CW4 A;  3L4I A;  1ZU3 A;  1C55 A;  1I2U A;  2V7Z A;  1KAX A;  1NGF A;  2VY6 A;  1VNA A;  2YIO A;  2LKB A;  4H5V A;  1T7B A;  2E3F A;  2KBJ A;  1L4V A;  1T1T A;  5FPD A;  5KK4 A;  5AQR A;  4UAE F;  2ASC A;  2D56 A;  2LY6 A;  5AQS A;  1B7D A;  2N66 A;  2YEO A;  2MZ0 A;  5AQU A;  5AQF A;  1MYN A;  2QWM A;  1KV0 A;  2B3C A;  2KHO A;  3D2F B;  1HJO A;  5AQV A;  1HPM A;  1OZZ A;  2G2K A;  1ZUT A; 
#chains in the Genus database with same CATH homology
 1P0A A;  1NPI A;  1ZFU A;  2N69 A;  1BRZ A;  2N2R A;  4HE7 A;  2KPY A;  4AB0 A;  1GPT A;  2I61 A;  4KYP A;  1ICA A;  1GPS A;  1ZYW A;  1AHO A;  4HHF A;  1ZYV A;  1B3C A;  4V1D C;  2ATB A;  1SEG A;  1WT7 A;  2N2Q A;  4AEI A;  1SNB A;  1I2V A;  2KJA A;  1VNB A;  1SN1 A;  2BRZ A;  1NH5 A;  1NRB A;  1WWN A;  3PSM A;  1PX9 A;  4CQK A;  2KSK A;  1C56 A;  1CN2 A;  1JZA A;  2LT8 A;  1T7E A;  5CY0 A;  2YC1 C;  1CHZ A;  1I6F A;  1MR4 A;  2KBH A;  2E3G A;  2NY8 X;  1JXC A;  2KBK A;  2LJ7 A;  1ZVG A;  1T7A A;  1AYJ A;  2E0H A;  1OMY A;  1WMT A;  2KGQ A;  1NRA A;  1BMR A;  1DQ7 A;  3E7R L;  1JKZ A;  2KYQ A;  4AAZ A;  4UJ0 A;  1BK8 A;  1PE4 A;  1LQH A;  2LI7 A;  2A7T A;  1I6G A;  2LY5 A;  1LQI A;  1P00 A;  1PTX A;  1JZB A;  2B68 A;  1N4N A;  1FH3 A;  1T0Z A;  1LQQ A;  2M8B B;  2YBR C;  2LR3 A;  2LJM A;  1NE5 A;  1BCG A;  1SN4 A;  1ZVE A;  2SN3 A;  1DJT A;  1TI5 A;  2GL1 A;  3E7U X;  1ZU3 A;  1C55 A;  1I2U A;  1VNA A;  2LKB A;  1T7B A;  2E3F A;  2KBJ A;  1L4V A;  1T1T A;  5KK4 A;  2ASC A;  2LY6 A;  1B7D A;  2N66 A;  2YEO A;  2MZ0 A;  1MYN A;  1KV0 A;  2B3C A;  1OZZ A;  2NY9 X;  1ZUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...