1C55A

Nmr solution structure of butantoxin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
40
structure length
40
Chain Sequence
WCSTCLDLACGASRECYDPCFKAFGRAHGKCMNNKCRCYT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords BUTANTOXIN
publication title NMR solution structure of butantoxin.
pubmed doi rcsb
total genus 5
structure length 40
sequence length 40
ec nomenclature
pdb deposition date 1999-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00451 Toxin_2 Scorpion short toxin, BmKK2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1c55A00
1ICAA 1AHOA 1JKZA 1CN2A 1VNBA 1I2UA 2YC1C 2KGQA 4KYPA 2KSKA 4AB0A 1BRZA 3E7UX 1SN4A 1NH5A 1ZYVA 1I6FA 2NY9X 1T7BA 2M8BB 1VNAA 4HHFA 1CHZA 2N2RA 1GPTA 2ASCA 1DJTA 2KJAA 1T0ZA 2GL1A 2LKBA 1LQQA 4AAZA 2KBKA 2N2QA 2YEOA 1TI5A 1ZU3A 4AEIA 1JXCA 3E7RL 2BRZA 2E3GA 1JZAA 2SN3A 2N69A 1NPIA 2LJ7A 1BMRA 1SEGA 1N4NA 5CY0A 1B7DA 2YBRC 2KYQA 1MYNA 1C56A 1NRBA 4HE7A 2LT8A 1JZBA 1FH3A 1WWNA 1WT7A 1C55A 1OMYA 5KK4A 1B3CA 1DQ7A 1OZZA 1MR4A 1ZVEA 2LY5A 1WMTA 2NY8X 1KV0A 1AYJA 1I2VA 1L4VA 1ZYWA 2LJMA 4UJ0A 4V1DC 1SN1A 2LI7A 1ZUTA 2I61A 1T7EA 1GPSA 1ZFUA 2KBHA 2KPYA 1ZVGA 1T7AA 2B3CA 2ATBA 2MZ0A 2A7TA 1PE4A 4CQKA 1PX9A 2E3FA 3PSMA 2LY6A 1LQIA 1NE5A 1PTXA 2N66A 1T1TA 1BCGA 1SNBA 1P0AA 1BK8A 2KBJA 1P00A 1LQHA 2LR3A 1I6GA 2E0HA 2B68A 1NRAA
chains in the Genus database with same CATH superfamily
3D2FA 5BPNA 5BPMA 1AHOA 3CW4A 3LDNA 5AQFA 3C7NA 1VNBA 2LN8A 3KOZA 5AQZA 2E2FA 2YC1C 2KGQA 3BK3C 2KSKA 3QFUA 4HWIA 4KYPA 2BUPA 5AQKA 4AB0A 1ATSA 1BRZA 3KC6A 1K8BA 3E7UX 1SN4A 3KOXA 3CQXA 3D2FB 3FZMA 1NH5A 1ZYVA 3QI7A 1I6FA 3C7NB 2NY9X 1T7BA 3GL1A 3L56A 2M8BB 1VNAA 4H5NA 4HHFA 5F2RA 4UADE 1CHZA 1POIA 2N2RA 5AQIA 1GPTA 2ASCA 1DJTA 4UAFE 5FPDA 1UGLA 2KJAA 1T0ZA 2GL1A 2LKBA 1LQQA 4AAZA 5F1XA 2KBKA 3KOYA 3FZLA 2N2QA 3FZFA 2YEOA 5FPMA 1TI5A 2QXLA 1ZU3A 4AEIA 3KP0A 5EXWA 2YILA 1JXCA 1NGJA 3E7RL 1NGEA 2BRZA 2E3GA 3A8YA 1DKGD 1NGDA 5AQSA 1NGCA 1JZAA 2SN3A 1NGAA 2YIPA 3FZKA 5AQHA 2N69A 1NPIA 2LJ7A 3L4IA 5AR0A 1QQOA 3QMLA 2QWMA 3LDOA 1NGIA 2E8AA 5AQUA 1BMRA 1SEGA 1N4NA 1NGHA 3AY9A 5AQYA 1HJOA 2QWQA 2QWPA 5CY0A 1B7DA 2YBRC 1HPMA 2KYQA 4H5TA 5AQQA 2K35A 5EX5A 1MYNA 4FL9A 1C56A 5AQPA 3IUCA 1NRBA 1JKZA 4HE7A 2LT8A 3LDPA 3KP1A 5BN9A 1JZBA 1ATRA 1FH3A 1WWNA 3L6QA 3HSCA 1WT7A 3I33A 3M3ZA 1C55A 5AQMA 2GMOA 1NGBA 1OMYA 1XRSB 5AQWA 5KK4A 3FZHA 3GKUA 4H5WA 5F0XA 5AQLA 5AQOA 1KAXA 3FE1A 1B3CA 1ICAA 1DQ7A 1OZZA 1MR4A 1YUWA 1ZVEA 2LY5A 1HX1A 1WMTA 3D2EB 2NY8X 4H5RA 5BPLA 1KAYA 1BA1A 1KV0A 1AYJA 1I2VA 2KHOA 3KVGA 2QWNA 1L4VA 1ZYWA 2QW9A 2LJMA 1I2UA 4KBOA 4V1DC 4UJ0A 1SN1A 2LI7A 1ZUTA 2I61A 3LDLA 1T7EA 4H5VA 1GPSA 1ZFUA 2KBHA 2KPYA 5AQXA 1ZVGA 1S3XA 3QFPA 2D56A 1NGFA 5EY4A 1T7AA 2B3CA 2ATBA 3JXUA 2MZ0A 5AQNA 2E88A 2A7TA 2MN5A 5AQJA 1PE4A 4CQKA 2MBKA 1PX9A 2E3FA 3R2VA 2JDQD 3PSMA 2QWOA 4FSVA 5AQTA 3D2EA 3LDQA 4IO8A 1CN2A 2LY6A 1LQIA 1NE5A 1PTXA 2QWRA 3KHWA 5BN8A 2G2KA 2N66A 1QQNA 1BCGA 1T1TA 3ATVA 3SF4D 1BUPA 1SNBA 4GNIA 4UAEF 1P0AA 3KOWA 1QQMA 1NGGA 2QWLA 5AQGA 5AQVA 2KBJA 5FPNA 5FPEA 1BK8A 1P00A 1LQHA 1KAZA 2LR3A 1I6GA 1BA0A 5EVZA 2E0HA 2V7ZA 3GDQA 5AQRA 2VY6A 2B68A 3ATUA 2YIOA 1NRAA
chains in the Genus database with same CATH topology
1ICAA 1AHOA 1JKZA 1CN2A 1VNBA 1I2UA 2YC1C 2KGQA 4KYPA 2KSKA 4AB0A 1BRZA 3E7UX 1SN4A 1NH5A 1ZYVA 1I6FA 2NY9X 1T7BA 2M8BB 1VNAA 4HHFA 1CHZA 2N2RA 1GPTA 2ASCA 1DJTA 2KJAA 1T0ZA 2GL1A 2LKBA 1LQQA 4AAZA 2KBKA 2N2QA 2YEOA 1TI5A 1ZU3A 4AEIA 1JXCA 3E7RL 2BRZA 2E3GA 1JZAA 2SN3A 2N69A 1NPIA 2LJ7A 1BMRA 1SEGA 1N4NA 5CY0A 1B7DA 2YBRC 2KYQA 1MYNA 1C56A 1NRBA 4HE7A 2LT8A 1JZBA 1FH3A 1WWNA 1WT7A 1C55A 1OMYA 5KK4A 1B3CA 1DQ7A 1OZZA 1MR4A 1ZVEA 2LY5A 1WMTA 2NY8X 1KV0A 1AYJA 1I2VA 1L4VA 1ZYWA 2LJMA 4UJ0A 4V1DC 1SN1A 2LI7A 1ZUTA 2I61A 1T7EA 1GPSA 1ZFUA 2KBHA 2KPYA 1ZVGA 1T7AA 2B3CA 2ATBA 2MZ0A 2A7TA 1PE4A 4CQKA 1PX9A 2E3FA 3PSMA 2LY6A 1LQIA 1NE5A 1PTXA 2N66A 1T1TA 1BCGA 1SNBA 1P0AA 1BK8A 2KBJA 1P00A 1LQHA 2LR3A 1I6GA 2E0HA 2B68A 1NRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICA A;  1AHO A;  1JKZ A;  1CN2 A;  1VNB A;  1I2U A;  2YC1 C;  2KGQ A;  4KYP A;  2KSK A;  4AB0 A;  1BRZ A;  3E7U X;  1SN4 A;  1NH5 A;  1ZYV A;  1I6F A;  2NY9 X;  1T7B A;  2M8B B;  1VNA A;  4HHF A;  1CHZ A;  2N2R A;  1GPT A;  2ASC A;  1DJT A;  2KJA A;  1T0Z A;  2GL1 A;  2LKB A;  1LQQ A;  4AAZ A;  2KBK A;  2N2Q A;  2YEO A;  1TI5 A;  1ZU3 A;  4AEI A;  1JXC A;  3E7R L;  2BRZ A;  2E3G A;  1JZA A;  2SN3 A;  2N69 A;  1NPI A;  2LJ7 A;  1BMR A;  1SEG A;  1N4N A;  5CY0 A;  1B7D A;  2YBR C;  2KYQ A;  1MYN A;  1C56 A;  1NRB A;  4HE7 A;  2LT8 A;  1JZB A;  1FH3 A;  1WWN A;  1WT7 A;  1C55 A;  1OMY A;  5KK4 A;  1B3C A;  1DQ7 A;  1OZZ A;  1MR4 A;  1ZVE A;  2LY5 A;  1WMT A;  2NY8 X;  1KV0 A;  1AYJ A;  1I2V A;  1L4V A;  1ZYW A;  2LJM A;  4UJ0 A;  4V1D C;  1SN1 A;  2LI7 A;  1ZUT A;  2I61 A;  1T7E A;  1GPS A;  1ZFU A;  2KBH A;  2KPY A;  1ZVG A;  1T7A A;  2B3C A;  2ATB A;  2MZ0 A;  2A7T A;  1PE4 A;  4CQK A;  1PX9 A;  2E3F A;  3PSM A;  2LY6 A;  1LQI A;  1NE5 A;  1PTX A;  2N66 A;  1T1T A;  1BCG A;  1SNB A;  1P0A A;  1BK8 A;  2KBJ A;  1P00 A;  1LQH A;  2LR3 A;  1I6G A;  2E0H A;  2B68 A;  1NRA A; 
#chains in the Genus database with same CATH topology
 3D2F A;  5BPN A;  5BPM A;  1AHO A;  3CW4 A;  3LDN A;  5AQF A;  3C7N A;  1VNB A;  2LN8 A;  3KOZ A;  5AQZ A;  2E2F A;  2YC1 C;  2KGQ A;  3BK3 C;  2KSK A;  3QFU A;  4HWI A;  4KYP A;  2BUP A;  5AQK A;  4AB0 A;  1ATS A;  1BRZ A;  3KC6 A;  1K8B A;  3E7U X;  1SN4 A;  3KOX A;  3CQX A;  3D2F B;  3FZM A;  1NH5 A;  1ZYV A;  3QI7 A;  1I6F A;  3C7N B;  2NY9 X;  1T7B A;  3GL1 A;  3L56 A;  2M8B B;  1VNA A;  4H5N A;  4HHF A;  5F2R A;  4UAD E;  1CHZ A;  1POI A;  2N2R A;  5AQI A;  1GPT A;  2ASC A;  1DJT A;  4UAF E;  5FPD A;  1UGL A;  2KJA A;  1T0Z A;  2GL1 A;  2LKB A;  1LQQ A;  4AAZ A;  5F1X A;  2KBK A;  3KOY A;  3FZL A;  2N2Q A;  3FZF A;  2YEO A;  5FPM A;  1TI5 A;  2QXL A;  1ZU3 A;  4AEI A;  3KP0 A;  5EXW A;  2YIL A;  1JXC A;  1NGJ A;  3E7R L;  1NGE A;  2BRZ A;  2E3G A;  3A8Y A;  1DKG D;  1NGD A;  5AQS A;  1NGC A;  1JZA A;  2SN3 A;  1NGA A;  2YIP A;  3FZK A;  5AQH A;  2N69 A;  1NPI A;  2LJ7 A;  3L4I A;  5AR0 A;  1QQO A;  3QML A;  2QWM A;  3LDO A;  1NGI A;  2E8A A;  5AQU A;  1BMR A;  1SEG A;  1N4N A;  1NGH A;  3AY9 A;  5AQY A;  1HJO A;  2QWQ A;  2QWP A;  5CY0 A;  1B7D A;  2YBR C;  1HPM A;  2KYQ A;  4H5T A;  5AQQ A;  2K35 A;  5EX5 A;  1MYN A;  4FL9 A;  1C56 A;  5AQP A;  3IUC A;  1NRB A;  1JKZ A;  4HE7 A;  2LT8 A;  3LDP A;  3KP1 A;  5BN9 A;  1JZB A;  1ATR A;  1FH3 A;  1WWN A;  3L6Q A;  3HSC A;  1WT7 A;  3I33 A;  3M3Z A;  1C55 A;  5AQM A;  2GMO A;  1NGB A;  1OMY A;  1XRS B;  5AQW A;  5KK4 A;  3FZH A;  3GKU A;  4H5W A;  5F0X A;  5AQL A;  5AQO A;  1KAX A;  3FE1 A;  1B3C A;  1ICA A;  1DQ7 A;  1OZZ A;  1MR4 A;  1YUW A;  1ZVE A;  2LY5 A;  1HX1 A;  1WMT A;  3D2E B;  2NY8 X;  4H5R A;  5BPL A;  1KAY A;  1BA1 A;  1KV0 A;  1AYJ A;  1I2V A;  2KHO A;  3KVG A;  2QWN A;  1L4V A;  1ZYW A;  2QW9 A;  2LJM A;  1I2U A;  4KBO A;  4V1D C;  4UJ0 A;  1SN1 A;  2LI7 A;  1ZUT A;  2I61 A;  3LDL A;  1T7E A;  4H5V A;  1GPS A;  1ZFU A;  2KBH A;  2KPY A;  5AQX A;  1ZVG A;  1S3X A;  3QFP A;  2D56 A;  1NGF A;  5EY4 A;  1T7A A;  2B3C A;  2ATB A;  3JXU A;  2MZ0 A;  5AQN A;  2E88 A;  2A7T A;  2MN5 A;  5AQJ A;  1PE4 A;  4CQK A;  2MBK A;  1PX9 A;  2E3F A;  3R2V A;  2JDQ D;  3PSM A;  2QWO A;  4FSV A;  5AQT A;  3D2E A;  3LDQ A;  4IO8 A;  1CN2 A;  2LY6 A;  1LQI A;  1NE5 A;  1PTX A;  2QWR A;  3KHW A;  5BN8 A;  2G2K A;  2N66 A;  1QQN A;  1BCG A;  1T1T A;  3ATV A;  3SF4 D;  1BUP A;  1SNB A;  4GNI A;  4UAE F;  1P0A A;  3KOW A;  1QQM A;  1NGG A;  2QWL A;  5AQG A;  5AQV A;  2KBJ A;  5FPN A;  5FPE A;  1BK8 A;  1P00 A;  1LQH A;  1KAZ A;  2LR3 A;  1I6G A;  1BA0 A;  5EVZ A;  2E0H A;  2V7Z A;  3GDQ A;  5AQR A;  2VY6 A;  2B68 A;  3ATU A;  2YIO A;  1NRA A; 
#chains in the Genus database with same CATH homology
 1ICA A;  1AHO A;  1JKZ A;  1CN2 A;  1VNB A;  1I2U A;  2YC1 C;  2KGQ A;  4KYP A;  2KSK A;  4AB0 A;  1BRZ A;  3E7U X;  1SN4 A;  1NH5 A;  1ZYV A;  1I6F A;  2NY9 X;  1T7B A;  2M8B B;  1VNA A;  4HHF A;  1CHZ A;  2N2R A;  1GPT A;  2ASC A;  1DJT A;  2KJA A;  1T0Z A;  2GL1 A;  2LKB A;  1LQQ A;  4AAZ A;  2KBK A;  2N2Q A;  2YEO A;  1TI5 A;  1ZU3 A;  4AEI A;  1JXC A;  3E7R L;  2BRZ A;  2E3G A;  1JZA A;  2SN3 A;  2N69 A;  1NPI A;  2LJ7 A;  1BMR A;  1SEG A;  1N4N A;  5CY0 A;  1B7D A;  2YBR C;  2KYQ A;  1MYN A;  1C56 A;  1NRB A;  4HE7 A;  2LT8 A;  1JZB A;  1FH3 A;  1WWN A;  1WT7 A;  1C55 A;  1OMY A;  5KK4 A;  1B3C A;  1DQ7 A;  1OZZ A;  1MR4 A;  1ZVE A;  2LY5 A;  1WMT A;  2NY8 X;  1KV0 A;  1AYJ A;  1I2V A;  1L4V A;  1ZYW A;  2LJM A;  4UJ0 A;  4V1D C;  1SN1 A;  2LI7 A;  1ZUT A;  2I61 A;  1T7E A;  1GPS A;  1ZFU A;  2KBH A;  2KPY A;  1ZVG A;  1T7A A;  2B3C A;  2ATB A;  2MZ0 A;  2A7T A;  1PE4 A;  4CQK A;  1PX9 A;  2E3F A;  3PSM A;  2LY6 A;  1LQI A;  1NE5 A;  1PTX A;  2N66 A;  1T1T A;  1BCG A;  1SNB A;  1P0A A;  1BK8 A;  2KBJ A;  1P00 A;  1LQH A;  2LR3 A;  1I6G A;  2E0H A;  2B68 A;  1NRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...