1CN2A

Solution structure of toxin 2 from centruroides noxius hoffmann, a beta scorpion neurotoxin acting on sodium channels, nmr, 15 structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
66
structure length
66
Chain Sequence
KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPLPNKRCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Neurotoxin
molecule keywords TOXIN 2
publication title Solution structure of toxin 2 from centruroides noxius Hoffmann, a beta-scorpion neurotoxin acting on sodium channels.
pubmed doi rcsb
total genus 14
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 1998-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1cn2A00
1T7BA 2GL1A 2N69A 1JZAA 2NY9X 4KYPA 1OZZA 4UJ0A 2KYQA 1T7EA 1NRAA 2N2RA 2LKBA 1CHZA 1SN4A 4HE7A 2KSKA 2LJMA 1P0AA 1LQQA 1TI5A 2N66A 1ZUTA 1MR4A 1BK8A 4AAZA 1SN1A 1LQHA 2LT8A 1I6GA 2B3CA 2A7TA 2NY8X 1VNAA 2KGQA 2LR3A 1NPIA 1DJTA 2LY6A 1VNBA 1PTXA 1KV0A 2YEOA 2KBJA 5KK4A 1C55A 1NE5A 2BRZA 1DQ7A 2N2QA 1I2VA 2YC1C 1MYNA 1OMYA 2SN3A 3PSMA 1BRZA 2MZ0A 2KBHA 1CN2A 1WWNA 1C56A 5CY0A 1B7DA 2YBRC 4AB0A 1PX9A 1AHOA 1JXCA 1JZBA 2LY5A 1SEGA 1I2UA 3E7UX 2I61A 2KBKA 1FH3A 1GPSA 1P00A 1ZU3A 2M8BB 1T7AA 1ZYVA 4V1DC 1ZYWA 1JKZA 1L4VA 4AEIA 2KJAA 1NRBA 2E0HA 1I6FA 2ATBA 2B68A 2E3FA 4CQKA 2KPYA 1AYJA 1WT7A 1PE4A 1ICAA 1N4NA 1ZVEA 2LI7A 1ZFUA 1SNBA 2E3GA 1WMTA 1GPTA 3E7RL 1LQIA 1BMRA 2LJ7A 1NH5A 2ASCA 4HHFA 1B3CA 1T1TA 1ZVGA 1BCGA 1T0ZA
chains in the Genus database with same CATH superfamily
3LDOA 1T7BA 2GL1A 2N69A 3L6QA 1JZAA 2NY9X 4KYPA 1BUPA 1ATRA 1OZZA 5FPMA 5AQLA 4UJ0A 2KYQA 5BPNA 3FZKA 2MBKA 1QQOA 1T7EA 5BN9A 1NRAA 3KVGA 3KOYA 2N2RA 5AQGA 4UAFE 2LKBA 1CHZA 2BUPA 1SN4A 4HE7A 2QWQA 2KSKA 2LJMA 1P0AA 5FPDA 1LQQA 1TI5A 3GKUA 5AQFA 2N66A 4FL9A 2GMOA 1ZUTA 2QW9A 1HX1A 2E8AA 1MR4A 1BK8A 5BPLA 1HPMA 1BA1A 1S3XA 1DKGD 2QWMA 5FPNA 4AAZA 1NGDA 3FZMA 1SN1A 1LQHA 2LT8A 1I6GA 1NGHA 3FZFA 2B3CA 2LN8A 2A7TA 2NY8X 1VNAA 3L4IA 4IO8A 2KGQA 2LR3A 1NPIA 5BN8A 1DJTA 2LY6A 1VNBA 2KHOA 3C7NB 5AQTA 1PTXA 1KV0A 2YEOA 4H5VA 1NGGA 2KBJA 5KK4A 2QWLA 5EY4A 1C55A 3KOWA 2E2FA 1NE5A 4H5WA 2K35A 2BRZA 3LDQA 1DQ7A 2N2QA 3HSCA 4FSVA 4GNIA 2YC1C 1I2VA 5BPMA 2MN5A 2YIPA 5AQKA 1MYNA 1OMYA 2SN3A 1POIA 1NGFA 3QFUA 3KC6A 2JDQD 5AQQA 5F0XA 3PSMA 1BRZA 1NGAA 3KP0A 2MZ0A 2KBHA 3D2EA 1CN2A 1WWNA 2VY6A 1C56A 2V7ZA 5AQIA 5AQUA 5F1XA 1YUWA 2D56A 4KBOA 5CY0A 1B7DA 4H5TA 1BA0A 5AQZA 2YBRC 3LDPA 3GDQA 4AB0A 3AY9A 1KAXA 1PX9A 1UGLA 5EVZA 3QI7A 1QQNA 1AHOA 4H5RA 1HJOA 1JXCA 3I33A 1JZBA 2LY5A 4UADE 3D2FA 1SEGA 3QFPA 1I2UA 3E7UX 3GL1A 2QWOA 2I61A 1QQMA 2KBKA 4H5NA 5AQJA 2YILA 1P00A 1ZU3A 3FZHA 2M8BB 5AQWA 1FH3A 1T7AA 3CQXA 1ZYVA 3LDNA 5AQRA 5FPEA 3KP1A 5AQPA 1NGIA 4V1DC 1ZYWA 1NGJA 2QWNA 5AR0A 1JKZA 4AEIA 1L4VA 2KJAA 1NRBA 1NGEA 2E0HA 1NGBA 1K8BA 1I6FA 3ATUA 2ATBA 2B68A 2E3FA 4CQKA 2KPYA 1XRSB 1WT7A 2QXLA 3FZLA 3M3ZA 1AYJA 5AQOA 1KAYA 3FE1A 3CW4A 3QMLA 1PE4A 3KHWA 5AQNA 5EX5A 3R2VA 1ICAA 1ATSA 1N4NA 1ZVEA 3ATVA 2LI7A 1ZFUA 1SNBA 2E3GA 1WMTA 1KAZA 1GPTA 3E7RL 1LQIA 3IUCA 3D2EB 1BMRA 3A8YA 3KOZA 5AQSA 5AQMA 2QWPA 5AQYA 2LJ7A 3SF4D 1GPSA 4UAEF 1NH5A 5AQXA 5EXWA 2ASCA 4HHFA 5AQHA 2G2KA 1B3CA 3C7NA 3D2FB 3LDLA 1T1TA 1ZVGA 5AQVA 3KOXA 1BCGA 1NGCA 2QWRA 2YIOA 3BK3C 3L56A 5F2RA 2E88A 3JXUA 1T0ZA 4HWIA
chains in the Genus database with same CATH topology
1T7BA 2GL1A 2N69A 1JZAA 2NY9X 4KYPA 1OZZA 4UJ0A 2KYQA 1T7EA 1NRAA 2N2RA 2LKBA 1CHZA 1SN4A 4HE7A 2KSKA 2LJMA 1P0AA 1LQQA 1TI5A 2N66A 1ZUTA 1MR4A 1BK8A 4AAZA 1SN1A 1LQHA 2LT8A 1I6GA 2B3CA 2A7TA 2NY8X 1VNAA 2KGQA 2LR3A 1NPIA 1DJTA 2LY6A 1VNBA 1PTXA 1KV0A 2YEOA 2KBJA 5KK4A 1C55A 1NE5A 2BRZA 1DQ7A 2N2QA 1I2VA 2YC1C 1MYNA 1OMYA 2SN3A 3PSMA 1BRZA 2MZ0A 2KBHA 1CN2A 1WWNA 1C56A 5CY0A 1B7DA 2YBRC 4AB0A 1PX9A 1AHOA 1JXCA 1JZBA 2LY5A 1SEGA 1I2UA 3E7UX 2I61A 2KBKA 1FH3A 1GPSA 1P00A 1ZU3A 2M8BB 1T7AA 1ZYVA 4V1DC 1ZYWA 1JKZA 1L4VA 4AEIA 2KJAA 1NRBA 2E0HA 1I6FA 2ATBA 2B68A 2E3FA 4CQKA 2KPYA 1AYJA 1WT7A 1PE4A 1ICAA 1N4NA 1ZVEA 2LI7A 1ZFUA 1SNBA 2E3GA 1WMTA 1GPTA 3E7RL 1LQIA 1BMRA 2LJ7A 1NH5A 2ASCA 4HHFA 1B3CA 1T1TA 1ZVGA 1BCGA 1T0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T7B A;  2GL1 A;  2N69 A;  1JZA A;  2NY9 X;  4KYP A;  1OZZ A;  4UJ0 A;  2KYQ A;  1T7E A;  1NRA A;  2N2R A;  2LKB A;  1CHZ A;  1SN4 A;  4HE7 A;  2KSK A;  2LJM A;  1P0A A;  1LQQ A;  1TI5 A;  2N66 A;  1ZUT A;  1MR4 A;  1BK8 A;  4AAZ A;  1SN1 A;  1LQH A;  2LT8 A;  1I6G A;  2B3C A;  2A7T A;  2NY8 X;  1VNA A;  2KGQ A;  2LR3 A;  1NPI A;  1DJT A;  2LY6 A;  1VNB A;  1PTX A;  1KV0 A;  2YEO A;  2KBJ A;  5KK4 A;  1C55 A;  1NE5 A;  2BRZ A;  1DQ7 A;  2N2Q A;  1I2V A;  2YC1 C;  1MYN A;  1OMY A;  2SN3 A;  3PSM A;  1BRZ A;  2MZ0 A;  2KBH A;  1CN2 A;  1WWN A;  1C56 A;  5CY0 A;  1B7D A;  2YBR C;  4AB0 A;  1PX9 A;  1AHO A;  1JXC A;  1JZB A;  2LY5 A;  1SEG A;  1I2U A;  3E7U X;  2I61 A;  2KBK A;  1FH3 A;  1GPS A;  1P00 A;  1ZU3 A;  2M8B B;  1T7A A;  1ZYV A;  4V1D C;  1ZYW A;  1JKZ A;  1L4V A;  4AEI A;  2KJA A;  1NRB A;  2E0H A;  1I6F A;  2ATB A;  2B68 A;  2E3F A;  4CQK A;  2KPY A;  1AYJ A;  1WT7 A;  1PE4 A;  1ICA A;  1N4N A;  1ZVE A;  2LI7 A;  1ZFU A;  1SNB A;  2E3G A;  1WMT A;  1GPT A;  3E7R L;  1LQI A;  1BMR A;  2LJ7 A;  1NH5 A;  2ASC A;  4HHF A;  1B3C A;  1T1T A;  1ZVG A;  1BCG A;  1T0Z A; 
#chains in the Genus database with same CATH topology
 3LDO A;  1T7B A;  2GL1 A;  2N69 A;  3L6Q A;  1JZA A;  2NY9 X;  4KYP A;  1BUP A;  1ATR A;  1OZZ A;  5FPM A;  5AQL A;  4UJ0 A;  2KYQ A;  5BPN A;  3FZK A;  2MBK A;  1QQO A;  1T7E A;  5BN9 A;  1NRA A;  3KVG A;  3KOY A;  2N2R A;  5AQG A;  4UAF E;  2LKB A;  1CHZ A;  2BUP A;  1SN4 A;  4HE7 A;  2QWQ A;  2KSK A;  2LJM A;  1P0A A;  5FPD A;  1LQQ A;  1TI5 A;  3GKU A;  5AQF A;  2N66 A;  4FL9 A;  2GMO A;  1ZUT A;  2QW9 A;  1HX1 A;  2E8A A;  1MR4 A;  1BK8 A;  5BPL A;  1HPM A;  1BA1 A;  1S3X A;  1DKG D;  2QWM A;  5FPN A;  4AAZ A;  1NGD A;  3FZM A;  1SN1 A;  1LQH A;  2LT8 A;  1I6G A;  1NGH A;  3FZF A;  2B3C A;  2LN8 A;  2A7T A;  2NY8 X;  1VNA A;  3L4I A;  4IO8 A;  2KGQ A;  2LR3 A;  1NPI A;  5BN8 A;  1DJT A;  2LY6 A;  1VNB A;  2KHO A;  3C7N B;  5AQT A;  1PTX A;  1KV0 A;  2YEO A;  4H5V A;  1NGG A;  2KBJ A;  5KK4 A;  2QWL A;  5EY4 A;  1C55 A;  3KOW A;  2E2F A;  1NE5 A;  4H5W A;  2K35 A;  2BRZ A;  3LDQ A;  1DQ7 A;  2N2Q A;  3HSC A;  4FSV A;  4GNI A;  2YC1 C;  1I2V A;  5BPM A;  2MN5 A;  2YIP A;  5AQK A;  1MYN A;  1OMY A;  2SN3 A;  1POI A;  1NGF A;  3QFU A;  3KC6 A;  2JDQ D;  5AQQ A;  5F0X A;  3PSM A;  1BRZ A;  1NGA A;  3KP0 A;  2MZ0 A;  2KBH A;  3D2E A;  1CN2 A;  1WWN A;  2VY6 A;  1C56 A;  2V7Z A;  5AQI A;  5AQU A;  5F1X A;  1YUW A;  2D56 A;  4KBO A;  5CY0 A;  1B7D A;  4H5T A;  1BA0 A;  5AQZ A;  2YBR C;  3LDP A;  3GDQ A;  4AB0 A;  3AY9 A;  1KAX A;  1PX9 A;  1UGL A;  5EVZ A;  3QI7 A;  1QQN A;  1AHO A;  4H5R A;  1HJO A;  1JXC A;  3I33 A;  1JZB A;  2LY5 A;  4UAD E;  3D2F A;  1SEG A;  3QFP A;  1I2U A;  3E7U X;  3GL1 A;  2QWO A;  2I61 A;  1QQM A;  2KBK A;  4H5N A;  5AQJ A;  2YIL A;  1P00 A;  1ZU3 A;  3FZH A;  2M8B B;  5AQW A;  1FH3 A;  1T7A A;  3CQX A;  1ZYV A;  3LDN A;  5AQR A;  5FPE A;  3KP1 A;  5AQP A;  1NGI A;  4V1D C;  1ZYW A;  1NGJ A;  2QWN A;  5AR0 A;  1JKZ A;  4AEI A;  1L4V A;  2KJA A;  1NRB A;  1NGE A;  2E0H A;  1NGB A;  1K8B A;  1I6F A;  3ATU A;  2ATB A;  2B68 A;  2E3F A;  4CQK A;  2KPY A;  1XRS B;  1WT7 A;  2QXL A;  3FZL A;  3M3Z A;  1AYJ A;  5AQO A;  1KAY A;  3FE1 A;  3CW4 A;  3QML A;  1PE4 A;  3KHW A;  5AQN A;  5EX5 A;  3R2V A;  1ICA A;  1ATS A;  1N4N A;  1ZVE A;  3ATV A;  2LI7 A;  1ZFU A;  1SNB A;  2E3G A;  1WMT A;  1KAZ A;  1GPT A;  3E7R L;  1LQI A;  3IUC A;  3D2E B;  1BMR A;  3A8Y A;  3KOZ A;  5AQS A;  5AQM A;  2QWP A;  5AQY A;  2LJ7 A;  3SF4 D;  1GPS A;  4UAE F;  1NH5 A;  5AQX A;  5EXW A;  2ASC A;  4HHF A;  5AQH A;  2G2K A;  1B3C A;  3C7N A;  3D2F B;  3LDL A;  1T1T A;  1ZVG A;  5AQV A;  3KOX A;  1BCG A;  1NGC A;  2QWR A;  2YIO A;  3BK3 C;  3L56 A;  5F2R A;  2E88 A;  3JXU A;  1T0Z A;  4HWI A; 
#chains in the Genus database with same CATH homology
 1T7B A;  2GL1 A;  2N69 A;  1JZA A;  2NY9 X;  4KYP A;  1OZZ A;  4UJ0 A;  2KYQ A;  1T7E A;  1NRA A;  2N2R A;  2LKB A;  1CHZ A;  1SN4 A;  4HE7 A;  2KSK A;  2LJM A;  1P0A A;  1LQQ A;  1TI5 A;  2N66 A;  1ZUT A;  1MR4 A;  1BK8 A;  4AAZ A;  1SN1 A;  1LQH A;  2LT8 A;  1I6G A;  2B3C A;  2A7T A;  2NY8 X;  1VNA A;  2KGQ A;  2LR3 A;  1NPI A;  1DJT A;  2LY6 A;  1VNB A;  1PTX A;  1KV0 A;  2YEO A;  2KBJ A;  5KK4 A;  1C55 A;  1NE5 A;  2BRZ A;  1DQ7 A;  2N2Q A;  1I2V A;  2YC1 C;  1MYN A;  1OMY A;  2SN3 A;  3PSM A;  1BRZ A;  2MZ0 A;  2KBH A;  1CN2 A;  1WWN A;  1C56 A;  5CY0 A;  1B7D A;  2YBR C;  4AB0 A;  1PX9 A;  1AHO A;  1JXC A;  1JZB A;  2LY5 A;  1SEG A;  1I2U A;  3E7U X;  2I61 A;  2KBK A;  1FH3 A;  1GPS A;  1P00 A;  1ZU3 A;  2M8B B;  1T7A A;  1ZYV A;  4V1D C;  1ZYW A;  1JKZ A;  1L4V A;  4AEI A;  2KJA A;  1NRB A;  2E0H A;  1I6F A;  2ATB A;  2B68 A;  2E3F A;  4CQK A;  2KPY A;  1AYJ A;  1WT7 A;  1PE4 A;  1ICA A;  1N4N A;  1ZVE A;  2LI7 A;  1ZFU A;  1SNB A;  2E3G A;  1WMT A;  1GPT A;  3E7R L;  1LQI A;  1BMR A;  2LJ7 A;  1NH5 A;  2ASC A;  4HHF A;  1B3C A;  1T1T A;  1ZVG A;  1BCG A;  1T0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...