1FH3A

Nmr structures of lqh iii alpha-like scorpion toxin from leiurus quinquestriatus corresponding to the major conformer in solution
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
VRDGYIAQPENCVYHCFPGSSGCDTLCKEKGGTSGHCGFKVGHGLACWCNALPDNVGIIVEGEKCHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords LQH III ALPHA-LIKE TOXIN
publication title A Cis-trans Isomerism of a Non-prolyl Peptide Bond in Lqh III Alpha-like Scorpion Toxin Revealed by Solution NMR
rcsb
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2000-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1fh3A00
1N4NA 2KGQA 1ZYWA 1AYJA 2A7TA 1NRBA 1NH5A 1ZU3A 2B3CA 1PX9A 4AEIA 1LQHA 1AHOA 1JZBA 2LY6A 1I6FA 2LJMA 4V1DC 1WWNA 1NE5A 1ZYVA 1GPTA 2MZ0A 1CN2A 1ZUTA 1C55A 2E3FA 1ZVGA 1OZZA 4CQKA 5KK4A 3E7UX 2N2RA 1P00A 2KYQA 2KBHA 1LQIA 2YEOA 2KBKA 2LR3A 1I2UA 2GL1A 2KPYA 4HHFA 1TI5A 1MR4A 2LJ7A 1SN4A 1T7EA 1P0AA 2YBRC 1BK8A 1L4VA 3E7RL 1OMYA 2M8BB 1T1TA 2ASCA 1MYNA 1ZFUA 2BRZA 2KJAA 4AB0A 2KSKA 2LI7A 2LT8A 3PSMA 2B68A 2N66A 1VNBA 4AAZA 1B7DA 1PE4A 2LY5A 2NY8X 1DJTA 2LKBA 1NRAA 1SNBA 4UJ0A 1DQ7A 5CY0A 1KV0A 1GPSA 1CHZA 2NY9X 1ZVEA 1T0ZA 1C56A 2KBJA 1T7AA 2E0HA 2N69A 1WT7A 1I2VA 1JXCA 1BMRA 1WMTA 1BRZA 1T7BA 1JKZA 1BCGA 1B3CA 1VNAA 1SEGA 1ICAA 1LQQA 1PTXA 4KYPA 1SN1A 2I61A 2N2QA 1FH3A 1I6GA 2ATBA 1JZAA 4HE7A 1NPIA 2SN3A 2YC1C 2E3GA
chains in the Genus database with same CATH superfamily
2QWNA 2YC1C 4UAEF 4FL9A 2QW9A 4UADE 1N4NA 2KGQA 1ZYWA 3KHWA 3I33A 3L6QA 5EY4A 2YIOA 3LDLA 1AYJA 2A7TA 1NRBA 5AQQA 2JDQD 1NH5A 3C7NB 1ZU3A 2B3CA 3L4IA 1PX9A 1HJOA 4H5VA 3FZMA 1AHOA 1LQHA 1JZBA 2LY6A 5AQPA 4AEIA 4H5TA 5EXWA 3FZKA 1I6FA 2LJMA 3FE1A 1YUWA 5AQOA 4V1DC 5FPNA 1WWNA 1NE5A 1ZYVA 1GPTA 1NGEA 2MZ0A 3GL1A 5F2RA 1CN2A 1ZUTA 1C55A 1K8BA 1KAYA 2E3FA 3IUCA 1OZZA 1ZVGA 5FPMA 1BA0A 2QWLA 4CQKA 5BPLA 1XRSB 5AQIA 2YIPA 3QFUA 5KK4A 3D2FB 3E7UX 3ATUA 3KP1A 5EX5A 5AQWA 2N2RA 3SF4D 5AQNA 1P00A 2KYQA 1NGFA 2KBHA 2QXLA 3FZHA 1LQIA 2VY6A 2KBKA 2LR3A 2YEOA 2GL1A 2V7ZA 2KPYA 5AQUA 5BPMA 5FPDA 3AY9A 4H5WA 4HHFA 1TI5A 1NGBA 1MR4A 2LJ7A 3C7NA 1SN4A 5AQHA 1T7EA 1P0AA 1S3XA 2YBRC 1BK8A 4GNIA 2GMOA 3KOZA 5AQXA 2LN8A 2G2KA 1L4VA 3E7RL 1NGCA 2D56A 1OMYA 3JXUA 2M8BB 3D2EB 3A8YA 1T1TA 3D2EA 3KP0A 5AQKA 2ASCA 3KVGA 3LDOA 2MBKA 1MYNA 1NGHA 1KAXA 1ZFUA 2BRZA 2KJAA 2QWMA 1KAZA 3BK3C 2QWOA 3D2FA 3FZFA 2KSKA 5AQLA 4AB0A 2K35A 2LI7A 1NGGA 3FZLA 5AQZA 2LT8A 2YILA 3PSMA 3LDPA 5AQFA 2B68A 5AQTA 3QI7A 2N66A 3KOWA 5FPEA 1VNBA 4AAZA 1BA1A 1B7DA 1PE4A 2LY5A 4FSVA 2NY8X 5AR0A 5BN8A 1DJTA 2LKBA 3LDNA 1NRAA 1SNBA 3QMLA 4UJ0A 5AQMA 2E8AA 5AQRA 3M3ZA 1HX1A 1NGIA 2KHOA 3KOYA 1DQ7A 5BN9A 5CY0A 1KV0A 1DKGD 1GPSA 4H5RA 3GDQA 1BUPA 1CHZA 2NY9X 4IO8A 1ZVEA 1I2UA 2E2FA 5AQVA 1T0ZA 1C56A 2KBJA 4H5NA 1T7AA 2E0HA 2N69A 1WT7A 2QWPA 5AQYA 1I2VA 1QQNA 1JXCA 2E88A 1QQMA 1WMTA 2MN5A 3ATVA 5EVZA 1BMRA 1BRZA 1T7BA 3HSCA 1JKZA 1BCGA 5AQSA 1QQOA 3CQXA 1VNAA 5AQJA 1B3CA 3LDQA 1SEGA 1ATSA 1ATRA 1ICAA 4UAFE 2QWQA 1LQQA 1NGJA 1PTXA 4KYPA 3QFPA 1SN1A 3L56A 3R2VA 2I61A 5BPNA 5F1XA 1HPMA 1NGAA 3GKUA 2BUPA 1UGLA 2N2QA 1FH3A 1I6GA 5AQGA 3CW4A 2ATBA 5F0XA 2QWRA 3KOXA 1JZAA 4KBOA 4HE7A 1NPIA 2SN3A 1POIA 4HWIA 1NGDA 3KC6A 2E3GA
chains in the Genus database with same CATH topology
1N4NA 2KGQA 1ZYWA 1AYJA 2A7TA 1NRBA 1NH5A 1ZU3A 2B3CA 1PX9A 4AEIA 1LQHA 1AHOA 1JZBA 2LY6A 1I6FA 2LJMA 4V1DC 1WWNA 1NE5A 1ZYVA 1GPTA 2MZ0A 1CN2A 1ZUTA 1C55A 2E3FA 1ZVGA 1OZZA 4CQKA 5KK4A 3E7UX 2N2RA 1P00A 2KYQA 2KBHA 1LQIA 2YEOA 2KBKA 2LR3A 1I2UA 2GL1A 2KPYA 4HHFA 1TI5A 1MR4A 2LJ7A 1SN4A 1T7EA 1P0AA 2YBRC 1BK8A 1L4VA 3E7RL 1OMYA 2M8BB 1T1TA 2ASCA 1MYNA 1ZFUA 2BRZA 2KJAA 4AB0A 2KSKA 2LI7A 2LT8A 3PSMA 2B68A 2N66A 1VNBA 4AAZA 1B7DA 1PE4A 2LY5A 2NY8X 1DJTA 2LKBA 1NRAA 1SNBA 4UJ0A 1DQ7A 5CY0A 1KV0A 1GPSA 1CHZA 2NY9X 1ZVEA 1T0ZA 1C56A 2KBJA 1T7AA 2E0HA 2N69A 1WT7A 1I2VA 1JXCA 1BMRA 1WMTA 1BRZA 1T7BA 1JKZA 1BCGA 1B3CA 1VNAA 1SEGA 1ICAA 1LQQA 1PTXA 4KYPA 1SN1A 2I61A 2N2QA 1FH3A 1I6GA 2ATBA 1JZAA 4HE7A 1NPIA 2SN3A 2YC1C 2E3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4N A;  2KGQ A;  1ZYW A;  1AYJ A;  2A7T A;  1NRB A;  1NH5 A;  1ZU3 A;  2B3C A;  1PX9 A;  4AEI A;  1LQH A;  1AHO A;  1JZB A;  2LY6 A;  1I6F A;  2LJM A;  4V1D C;  1WWN A;  1NE5 A;  1ZYV A;  1GPT A;  2MZ0 A;  1CN2 A;  1ZUT A;  1C55 A;  2E3F A;  1ZVG A;  1OZZ A;  4CQK A;  5KK4 A;  3E7U X;  2N2R A;  1P00 A;  2KYQ A;  2KBH A;  1LQI A;  2YEO A;  2KBK A;  2LR3 A;  1I2U A;  2GL1 A;  2KPY A;  4HHF A;  1TI5 A;  1MR4 A;  2LJ7 A;  1SN4 A;  1T7E A;  1P0A A;  2YBR C;  1BK8 A;  1L4V A;  3E7R L;  1OMY A;  2M8B B;  1T1T A;  2ASC A;  1MYN A;  1ZFU A;  2BRZ A;  2KJA A;  4AB0 A;  2KSK A;  2LI7 A;  2LT8 A;  3PSM A;  2B68 A;  2N66 A;  1VNB A;  4AAZ A;  1B7D A;  1PE4 A;  2LY5 A;  2NY8 X;  1DJT A;  2LKB A;  1NRA A;  1SNB A;  4UJ0 A;  1DQ7 A;  5CY0 A;  1KV0 A;  1GPS A;  1CHZ A;  2NY9 X;  1ZVE A;  1T0Z A;  1C56 A;  2KBJ A;  1T7A A;  2E0H A;  2N69 A;  1WT7 A;  1I2V A;  1JXC A;  1BMR A;  1WMT A;  1BRZ A;  1T7B A;  1JKZ A;  1BCG A;  1B3C A;  1VNA A;  1SEG A;  1ICA A;  1LQQ A;  1PTX A;  4KYP A;  1SN1 A;  2I61 A;  2N2Q A;  1FH3 A;  1I6G A;  2ATB A;  1JZA A;  4HE7 A;  1NPI A;  2SN3 A;  2YC1 C;  2E3G A; 
#chains in the Genus database with same CATH topology
 2QWN A;  2YC1 C;  4UAE F;  4FL9 A;  2QW9 A;  4UAD E;  1N4N A;  2KGQ A;  1ZYW A;  3KHW A;  3I33 A;  3L6Q A;  5EY4 A;  2YIO A;  3LDL A;  1AYJ A;  2A7T A;  1NRB A;  5AQQ A;  2JDQ D;  1NH5 A;  3C7N B;  1ZU3 A;  2B3C A;  3L4I A;  1PX9 A;  1HJO A;  4H5V A;  3FZM A;  1AHO A;  1LQH A;  1JZB A;  2LY6 A;  5AQP A;  4AEI A;  4H5T A;  5EXW A;  3FZK A;  1I6F A;  2LJM A;  3FE1 A;  1YUW A;  5AQO A;  4V1D C;  5FPN A;  1WWN A;  1NE5 A;  1ZYV A;  1GPT A;  1NGE A;  2MZ0 A;  3GL1 A;  5F2R A;  1CN2 A;  1ZUT A;  1C55 A;  1K8B A;  1KAY A;  2E3F A;  3IUC A;  1OZZ A;  1ZVG A;  5FPM A;  1BA0 A;  2QWL A;  4CQK A;  5BPL A;  1XRS B;  5AQI A;  2YIP A;  3QFU A;  5KK4 A;  3D2F B;  3E7U X;  3ATU A;  3KP1 A;  5EX5 A;  5AQW A;  2N2R A;  3SF4 D;  5AQN A;  1P00 A;  2KYQ A;  1NGF A;  2KBH A;  2QXL A;  3FZH A;  1LQI A;  2VY6 A;  2KBK A;  2LR3 A;  2YEO A;  2GL1 A;  2V7Z A;  2KPY A;  5AQU A;  5BPM A;  5FPD A;  3AY9 A;  4H5W A;  4HHF A;  1TI5 A;  1NGB A;  1MR4 A;  2LJ7 A;  3C7N A;  1SN4 A;  5AQH A;  1T7E A;  1P0A A;  1S3X A;  2YBR C;  1BK8 A;  4GNI A;  2GMO A;  3KOZ A;  5AQX A;  2LN8 A;  2G2K A;  1L4V A;  3E7R L;  1NGC A;  2D56 A;  1OMY A;  3JXU A;  2M8B B;  3D2E B;  3A8Y A;  1T1T A;  3D2E A;  3KP0 A;  5AQK A;  2ASC A;  3KVG A;  3LDO A;  2MBK A;  1MYN A;  1NGH A;  1KAX A;  1ZFU A;  2BRZ A;  2KJA A;  2QWM A;  1KAZ A;  3BK3 C;  2QWO A;  3D2F A;  3FZF A;  2KSK A;  5AQL A;  4AB0 A;  2K35 A;  2LI7 A;  1NGG A;  3FZL A;  5AQZ A;  2LT8 A;  2YIL A;  3PSM A;  3LDP A;  5AQF A;  2B68 A;  5AQT A;  3QI7 A;  2N66 A;  3KOW A;  5FPE A;  1VNB A;  4AAZ A;  1BA1 A;  1B7D A;  1PE4 A;  2LY5 A;  4FSV A;  2NY8 X;  5AR0 A;  5BN8 A;  1DJT A;  2LKB A;  3LDN A;  1NRA A;  1SNB A;  3QML A;  4UJ0 A;  5AQM A;  2E8A A;  5AQR A;  3M3Z A;  1HX1 A;  1NGI A;  2KHO A;  3KOY A;  1DQ7 A;  5BN9 A;  5CY0 A;  1KV0 A;  1DKG D;  1GPS A;  4H5R A;  3GDQ A;  1BUP A;  1CHZ A;  2NY9 X;  4IO8 A;  1ZVE A;  1I2U A;  2E2F A;  5AQV A;  1T0Z A;  1C56 A;  2KBJ A;  4H5N A;  1T7A A;  2E0H A;  2N69 A;  1WT7 A;  2QWP A;  5AQY A;  1I2V A;  1QQN A;  1JXC A;  2E88 A;  1QQM A;  1WMT A;  2MN5 A;  3ATV A;  5EVZ A;  1BMR A;  1BRZ A;  1T7B A;  3HSC A;  1JKZ A;  1BCG A;  5AQS A;  1QQO A;  3CQX A;  1VNA A;  5AQJ A;  1B3C A;  3LDQ A;  1SEG A;  1ATS A;  1ATR A;  1ICA A;  4UAF E;  2QWQ A;  1LQQ A;  1NGJ A;  1PTX A;  4KYP A;  3QFP A;  1SN1 A;  3L56 A;  3R2V A;  2I61 A;  5BPN A;  5F1X A;  1HPM A;  1NGA A;  3GKU A;  2BUP A;  1UGL A;  2N2Q A;  1FH3 A;  1I6G A;  5AQG A;  3CW4 A;  2ATB A;  5F0X A;  2QWR A;  3KOX A;  1JZA A;  4KBO A;  4HE7 A;  1NPI A;  2SN3 A;  1POI A;  4HWI A;  1NGD A;  3KC6 A;  2E3G A; 
#chains in the Genus database with same CATH homology
 1N4N A;  2KGQ A;  1ZYW A;  1AYJ A;  2A7T A;  1NRB A;  1NH5 A;  1ZU3 A;  2B3C A;  1PX9 A;  4AEI A;  1LQH A;  1AHO A;  1JZB A;  2LY6 A;  1I6F A;  2LJM A;  4V1D C;  1WWN A;  1NE5 A;  1ZYV A;  1GPT A;  2MZ0 A;  1CN2 A;  1ZUT A;  1C55 A;  2E3F A;  1ZVG A;  1OZZ A;  4CQK A;  5KK4 A;  3E7U X;  2N2R A;  1P00 A;  2KYQ A;  2KBH A;  1LQI A;  2YEO A;  2KBK A;  2LR3 A;  1I2U A;  2GL1 A;  2KPY A;  4HHF A;  1TI5 A;  1MR4 A;  2LJ7 A;  1SN4 A;  1T7E A;  1P0A A;  2YBR C;  1BK8 A;  1L4V A;  3E7R L;  1OMY A;  2M8B B;  1T1T A;  2ASC A;  1MYN A;  1ZFU A;  2BRZ A;  2KJA A;  4AB0 A;  2KSK A;  2LI7 A;  2LT8 A;  3PSM A;  2B68 A;  2N66 A;  1VNB A;  4AAZ A;  1B7D A;  1PE4 A;  2LY5 A;  2NY8 X;  1DJT A;  2LKB A;  1NRA A;  1SNB A;  4UJ0 A;  1DQ7 A;  5CY0 A;  1KV0 A;  1GPS A;  1CHZ A;  2NY9 X;  1ZVE A;  1T0Z A;  1C56 A;  2KBJ A;  1T7A A;  2E0H A;  2N69 A;  1WT7 A;  1I2V A;  1JXC A;  1BMR A;  1WMT A;  1BRZ A;  1T7B A;  1JKZ A;  1BCG A;  1B3C A;  1VNA A;  1SEG A;  1ICA A;  1LQQ A;  1PTX A;  4KYP A;  1SN1 A;  2I61 A;  2N2Q A;  1FH3 A;  1I6G A;  2ATB A;  1JZA A;  4HE7 A;  1NPI A;  2SN3 A;  2YC1 C;  2E3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...