1GPSA

Solution structure of gamma 1-h and gamma 1-p thionins from barley and wheat endosperm determined by 1h-nmr: a structural motif common to toxic arthropod proteins
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
47
structure length
47
Chain Sequence
KICRRRSAGFKGPCMSNKNCAQVCQQEGWGGGNCDGPFRRCKCIRQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Plant toxin
molecule keywords GAMMA-1-P THIONIN
publication title Solution structure of gamma 1-H and gamma 1-P thionins from barley and wheat endosperm determined by 1H-NMR: a structural motif common to toxic arthropod proteins.
pubmed doi rcsb
source organism Triticum turgidum
total genus 10
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 1992-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00304 Gamma-thionin Gamma-thionin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1gpsA00
2I61A 2N2RA 1BK8A 2KYQA 1NH5A 4AEIA 1L4VA 1OZZA 1I2UA 1NRAA 1CHZA 2KBJA 1VNAA 1P00A 4HE7A 2ATBA 1OMYA 1N4NA 1CN2A 1NPIA 2LJMA 1LQQA 4KYPA 1T0ZA 2LR3A 2KSKA 2KGQA 4CQKA 1JXCA 2LY6A 1SEGA 1KV0A 3E7UX 1P0AA 1GPSA 1PTXA 1AYJA 1ICAA 2E3FA 1BMRA 2LKBA 1I6FA 1MR4A 1C56A 2E0HA 1T7AA 2LT8A 1LQHA 2NY9X 2LJ7A 1SNBA 2KJAA 5CY0A 1MYNA 1WWNA 4AAZA 1ZUTA 1VNBA 2E3GA 1I2VA 2M8BB 1ZU3A 1PE4A 1BCGA 2MZ0A 1NRBA 2N69A 4HHFA 1DJTA 2N66A 1I6GA 1ZYVA 4AB0A 2ASCA 2KBKA 2KPYA 2YEOA 1NE5A 2KBHA 1T7EA 3E7RL 2GL1A 2LI7A 4V1DC 1FH3A 1B7DA 2BRZA 2N2QA 1T7BA 1PX9A 2YC1C 2LY5A 2B68A 2SN3A 5KK4A 1ZVGA 1SN1A 1B3CA 1C55A 1GPTA 2YBRC 1JZBA 2A7TA 1ZYWA 1JKZA 1JZAA 1LQIA 1DQ7A 3PSMA 1ZFUA 4UJ0A 1T1TA 2NY8X 2B3CA 1SN4A 1AHOA 1WMTA 1TI5A 1ZVEA 1WT7A 1BRZA
chains in the Genus database with same CATH superfamily
1NGHA 2I61A 1NGIA 2N2RA 1BK8A 1YUWA 3LDOA 1QQOA 1ATSA 5AQZA 3R2VA 1BA1A 2KYQA 1NH5A 4UADE 4AEIA 1L4VA 1QQNA 1NGAA 1BA0A 3KC6A 4UAFE 1OZZA 3JXUA 2V7ZA 1NRAA 1CHZA 1DKGD 2KBJA 1I2UA 2QW9A 2QWMA 1KAXA 1NGBA 1VNAA 1P00A 4HE7A 3FZMA 2ATBA 1OMYA 5AQHA 1N4NA 1CN2A 1NPIA 3FZLA 2LJMA 1LQQA 4KYPA 2QWLA 1T0ZA 3KOYA 4GNIA 5F1XA 5BPLA 2LR3A 3C7NB 4FL9A 2GMOA 3KOXA 5AQMA 1QQMA 2KSKA 2KGQA 2QWRA 5FPNA 4CQKA 1JXCA 2LY6A 1SEGA 1KV0A 3E7UX 1P0AA 2G2KA 1PTXA 1GPSA 1NGEA 2MBKA 1AYJA 3HSCA 1HPMA 2JDQD 1ICAA 2E3FA 3L6QA 1BMRA 2LKBA 1I6FA 1MR4A 3GKUA 1C56A 2E0HA 1NGFA 3D2FB 1T7AA 3L4IA 3LDLA 3QFPA 2YIOA 3QI7A 2LT8A 5AQKA 1LQHA 2NY9X 2LJ7A 1SNBA 2KJAA 3D2FA 5BN9A 3AY9A 5EVZA 1NGCA 2MN5A 3LDQA 1UGLA 3LDNA 4FSVA 2YILA 5AQQA 5CY0A 1HJOA 1K8BA 3KOZA 1NGDA 4HWIA 1MYNA 1WWNA 1POIA 2D56A 2E2FA 3LDPA 3CQXA 5AQGA 4AAZA 1ZUTA 4H5WA 5BPNA 1VNBA 2E3GA 4UAEF 5AQFA 1I2VA 2M8BB 3L56A 1NGJA 1ZU3A 1PE4A 2YIPA 1BCGA 3BK3C 3QFUA 3C7NA 2MZ0A 4H5VA 2VY6A 1NRBA 2N69A 5AQXA 5AQIA 4HHFA 1DJTA 2N66A 3ATUA 3KP1A 1I6GA 1ZYVA 3SF4D 2QWOA 3GL1A 3KVGA 4AB0A 5AQRA 2ASCA 3A8YA 5AQUA 2KBKA 5BN8A 2KPYA 1KAZA 2YEOA 3KHWA 3FZHA 1NE5A 2KBHA 2QXLA 5F2RA 5AQJA 5FPEA 1T7EA 5AQLA 5EXWA 3E7RL 2GL1A 5AQVA 2QWPA 5AQNA 2LI7A 4V1DC 5FPMA 1FH3A 1B7DA 2BRZA 3CW4A 1HX1A 2N2QA 5EY4A 1T7BA 1PX9A 2YC1C 2LY5A 2B68A 3FE1A 5AQPA 3FZFA 2QWQA 3M3ZA 2SN3A 5AQYA 5FPDA 5EX5A 1XRSB 5KK4A 1ZVGA 1SN1A 1B3CA 1BUPA 2KHOA 1C55A 1GPTA 2YBRC 1JZBA 2A7TA 1ATRA 2E8AA 1ZYWA 4H5TA 1JKZA 1KAYA 1JZAA 4KBOA 3FZKA 1LQIA 5AQSA 3QMLA 1NGGA 1DQ7A 5F0XA 3KP0A 4H5RA 3PSMA 1ZFUA 2K35A 4UJ0A 5BPMA 5AQWA 2E88A 3GDQA 1T1TA 5AQTA 1S3XA 3KOWA 2NY8X 3D2EB 2B3CA 1SN4A 1AHOA 1WMTA 1TI5A 2QWNA 3ATVA 4H5NA 3IUCA 1ZVEA 2LN8A 5AQOA 5AR0A 3I33A 1WT7A 1BRZA 3D2EA 2BUPA 4IO8A
chains in the Genus database with same CATH topology
2I61A 2N2RA 1BK8A 2KYQA 1NH5A 4AEIA 1L4VA 1OZZA 1I2UA 1NRAA 1CHZA 2KBJA 1VNAA 1P00A 4HE7A 2ATBA 1OMYA 1N4NA 1CN2A 1NPIA 2LJMA 1LQQA 4KYPA 1T0ZA 2LR3A 2KSKA 2KGQA 4CQKA 1JXCA 2LY6A 1SEGA 1KV0A 3E7UX 1P0AA 1GPSA 1PTXA 1AYJA 1ICAA 2E3FA 1BMRA 2LKBA 1I6FA 1MR4A 1C56A 2E0HA 1T7AA 2LT8A 1LQHA 2NY9X 2LJ7A 1SNBA 2KJAA 5CY0A 1MYNA 1WWNA 4AAZA 1ZUTA 1VNBA 2E3GA 1I2VA 2M8BB 1ZU3A 1PE4A 1BCGA 2MZ0A 1NRBA 2N69A 4HHFA 1DJTA 2N66A 1I6GA 1ZYVA 4AB0A 2ASCA 2KBKA 2KPYA 2YEOA 1NE5A 2KBHA 1T7EA 3E7RL 2GL1A 2LI7A 4V1DC 1FH3A 1B7DA 2BRZA 2N2QA 1T7BA 1PX9A 2YC1C 2LY5A 2B68A 2SN3A 5KK4A 1ZVGA 1SN1A 1B3CA 1C55A 1GPTA 2YBRC 1JZBA 2A7TA 1ZYWA 1JKZA 1JZAA 1LQIA 1DQ7A 3PSMA 1ZFUA 4UJ0A 1T1TA 2NY8X 2B3CA 1SN4A 1AHOA 1WMTA 1TI5A 1ZVEA 1WT7A 1BRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I61 A;  2N2R A;  1BK8 A;  2KYQ A;  1NH5 A;  4AEI A;  1L4V A;  1OZZ A;  1I2U A;  1NRA A;  1CHZ A;  2KBJ A;  1VNA A;  1P00 A;  4HE7 A;  2ATB A;  1OMY A;  1N4N A;  1CN2 A;  1NPI A;  2LJM A;  1LQQ A;  4KYP A;  1T0Z A;  2LR3 A;  2KSK A;  2KGQ A;  4CQK A;  1JXC A;  2LY6 A;  1SEG A;  1KV0 A;  3E7U X;  1P0A A;  1GPS A;  1PTX A;  1AYJ A;  1ICA A;  2E3F A;  1BMR A;  2LKB A;  1I6F A;  1MR4 A;  1C56 A;  2E0H A;  1T7A A;  2LT8 A;  1LQH A;  2NY9 X;  2LJ7 A;  1SNB A;  2KJA A;  5CY0 A;  1MYN A;  1WWN A;  4AAZ A;  1ZUT A;  1VNB A;  2E3G A;  1I2V A;  2M8B B;  1ZU3 A;  1PE4 A;  1BCG A;  2MZ0 A;  1NRB A;  2N69 A;  4HHF A;  1DJT A;  2N66 A;  1I6G A;  1ZYV A;  4AB0 A;  2ASC A;  2KBK A;  2KPY A;  2YEO A;  1NE5 A;  2KBH A;  1T7E A;  3E7R L;  2GL1 A;  2LI7 A;  4V1D C;  1FH3 A;  1B7D A;  2BRZ A;  2N2Q A;  1T7B A;  1PX9 A;  2YC1 C;  2LY5 A;  2B68 A;  2SN3 A;  5KK4 A;  1ZVG A;  1SN1 A;  1B3C A;  1C55 A;  1GPT A;  2YBR C;  1JZB A;  2A7T A;  1ZYW A;  1JKZ A;  1JZA A;  1LQI A;  1DQ7 A;  3PSM A;  1ZFU A;  4UJ0 A;  1T1T A;  2NY8 X;  2B3C A;  1SN4 A;  1AHO A;  1WMT A;  1TI5 A;  1ZVE A;  1WT7 A;  1BRZ A; 
#chains in the Genus database with same CATH topology
 1NGH A;  2I61 A;  1NGI A;  2N2R A;  1BK8 A;  1YUW A;  3LDO A;  1QQO A;  1ATS A;  5AQZ A;  3R2V A;  1BA1 A;  2KYQ A;  1NH5 A;  4UAD E;  4AEI A;  1L4V A;  1QQN A;  1NGA A;  1BA0 A;  3KC6 A;  4UAF E;  1OZZ A;  3JXU A;  2V7Z A;  1NRA A;  1CHZ A;  1DKG D;  2KBJ A;  1I2U A;  2QW9 A;  2QWM A;  1KAX A;  1NGB A;  1VNA A;  1P00 A;  4HE7 A;  3FZM A;  2ATB A;  1OMY A;  5AQH A;  1N4N A;  1CN2 A;  1NPI A;  3FZL A;  2LJM A;  1LQQ A;  4KYP A;  2QWL A;  1T0Z A;  3KOY A;  4GNI A;  5F1X A;  5BPL A;  2LR3 A;  3C7N B;  4FL9 A;  2GMO A;  3KOX A;  5AQM A;  1QQM A;  2KSK A;  2KGQ A;  2QWR A;  5FPN A;  4CQK A;  1JXC A;  2LY6 A;  1SEG A;  1KV0 A;  3E7U X;  1P0A A;  2G2K A;  1PTX A;  1GPS A;  1NGE A;  2MBK A;  1AYJ A;  3HSC A;  1HPM A;  2JDQ D;  1ICA A;  2E3F A;  3L6Q A;  1BMR A;  2LKB A;  1I6F A;  1MR4 A;  3GKU A;  1C56 A;  2E0H A;  1NGF A;  3D2F B;  1T7A A;  3L4I A;  3LDL A;  3QFP A;  2YIO A;  3QI7 A;  2LT8 A;  5AQK A;  1LQH A;  2NY9 X;  2LJ7 A;  1SNB A;  2KJA A;  3D2F A;  5BN9 A;  3AY9 A;  5EVZ A;  1NGC A;  2MN5 A;  3LDQ A;  1UGL A;  3LDN A;  4FSV A;  2YIL A;  5AQQ A;  5CY0 A;  1HJO A;  1K8B A;  3KOZ A;  1NGD A;  4HWI A;  1MYN A;  1WWN A;  1POI A;  2D56 A;  2E2F A;  3LDP A;  3CQX A;  5AQG A;  4AAZ A;  1ZUT A;  4H5W A;  5BPN A;  1VNB A;  2E3G A;  4UAE F;  5AQF A;  1I2V A;  2M8B B;  3L56 A;  1NGJ A;  1ZU3 A;  1PE4 A;  2YIP A;  1BCG A;  3BK3 C;  3QFU A;  3C7N A;  2MZ0 A;  4H5V A;  2VY6 A;  1NRB A;  2N69 A;  5AQX A;  5AQI A;  4HHF A;  1DJT A;  2N66 A;  3ATU A;  3KP1 A;  1I6G A;  1ZYV A;  3SF4 D;  2QWO A;  3GL1 A;  3KVG A;  4AB0 A;  5AQR A;  2ASC A;  3A8Y A;  5AQU A;  2KBK A;  5BN8 A;  2KPY A;  1KAZ A;  2YEO A;  3KHW A;  3FZH A;  1NE5 A;  2KBH A;  2QXL A;  5F2R A;  5AQJ A;  5FPE A;  1T7E A;  5AQL A;  5EXW A;  3E7R L;  2GL1 A;  5AQV A;  2QWP A;  5AQN A;  2LI7 A;  4V1D C;  5FPM A;  1FH3 A;  1B7D A;  2BRZ A;  3CW4 A;  1HX1 A;  2N2Q A;  5EY4 A;  1T7B A;  1PX9 A;  2YC1 C;  2LY5 A;  2B68 A;  3FE1 A;  5AQP A;  3FZF A;  2QWQ A;  3M3Z A;  2SN3 A;  5AQY A;  5FPD A;  5EX5 A;  1XRS B;  5KK4 A;  1ZVG A;  1SN1 A;  1B3C A;  1BUP A;  2KHO A;  1C55 A;  1GPT A;  2YBR C;  1JZB A;  2A7T A;  1ATR A;  2E8A A;  1ZYW A;  4H5T A;  1JKZ A;  1KAY A;  1JZA A;  4KBO A;  3FZK A;  1LQI A;  5AQS A;  3QML A;  1NGG A;  1DQ7 A;  5F0X A;  3KP0 A;  4H5R A;  3PSM A;  1ZFU A;  2K35 A;  4UJ0 A;  5BPM A;  5AQW A;  2E88 A;  3GDQ A;  1T1T A;  5AQT A;  1S3X A;  3KOW A;  2NY8 X;  3D2E B;  2B3C A;  1SN4 A;  1AHO A;  1WMT A;  1TI5 A;  2QWN A;  3ATV A;  4H5N A;  3IUC A;  1ZVE A;  2LN8 A;  5AQO A;  5AR0 A;  3I33 A;  1WT7 A;  1BRZ A;  3D2E A;  2BUP A;  4IO8 A; 
#chains in the Genus database with same CATH homology
 2I61 A;  2N2R A;  1BK8 A;  2KYQ A;  1NH5 A;  4AEI A;  1L4V A;  1OZZ A;  1I2U A;  1NRA A;  1CHZ A;  2KBJ A;  1VNA A;  1P00 A;  4HE7 A;  2ATB A;  1OMY A;  1N4N A;  1CN2 A;  1NPI A;  2LJM A;  1LQQ A;  4KYP A;  1T0Z A;  2LR3 A;  2KSK A;  2KGQ A;  4CQK A;  1JXC A;  2LY6 A;  1SEG A;  1KV0 A;  3E7U X;  1P0A A;  1GPS A;  1PTX A;  1AYJ A;  1ICA A;  2E3F A;  1BMR A;  2LKB A;  1I6F A;  1MR4 A;  1C56 A;  2E0H A;  1T7A A;  2LT8 A;  1LQH A;  2NY9 X;  2LJ7 A;  1SNB A;  2KJA A;  5CY0 A;  1MYN A;  1WWN A;  4AAZ A;  1ZUT A;  1VNB A;  2E3G A;  1I2V A;  2M8B B;  1ZU3 A;  1PE4 A;  1BCG A;  2MZ0 A;  1NRB A;  2N69 A;  4HHF A;  1DJT A;  2N66 A;  1I6G A;  1ZYV A;  4AB0 A;  2ASC A;  2KBK A;  2KPY A;  2YEO A;  1NE5 A;  2KBH A;  1T7E A;  3E7R L;  2GL1 A;  2LI7 A;  4V1D C;  1FH3 A;  1B7D A;  2BRZ A;  2N2Q A;  1T7B A;  1PX9 A;  2YC1 C;  2LY5 A;  2B68 A;  2SN3 A;  5KK4 A;  1ZVG A;  1SN1 A;  1B3C A;  1C55 A;  1GPT A;  2YBR C;  1JZB A;  2A7T A;  1ZYW A;  1JKZ A;  1JZA A;  1LQI A;  1DQ7 A;  3PSM A;  1ZFU A;  4UJ0 A;  1T1T A;  2NY8 X;  2B3C A;  1SN4 A;  1AHO A;  1WMT A;  1TI5 A;  1ZVE A;  1WT7 A;  1BRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...