1I2UA

Nmr solution structures of antifungal heliomicin
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
44
structure length
44
Chain Sequence
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifungal protein
molecule keywords DEFENSIN HELIOMICIN
publication title Solution structures of the antifungal heliomicin and a selected variant with both antibacterial and antifungal activities.
pubmed doi rcsb
source organism Heliothis virescens
total genus 11
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2001-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1i2uA00
1T0ZA 2N69A 1WT7A 2YBRC 2LY6A 1AHOA 1SN4A 2KBKA 2NY8X 1T7BA 2N2QA 2N2RA 2LI7A 4AB0A 2KPYA 1JXCA 3E7RL 1ICAA 2I61A 1BRZA 1JZBA 5CY0A 1T7EA 2SN3A 2LJMA 2YC1C 1ZYVA 2B3CA 4AAZA 2KGQA 1NPIA 1ZYWA 1I6FA 4HHFA 4UJ0A 1SN1A 1TI5A 4CQKA 1GPTA 1NE5A 2N66A 2KBHA 3E7UX 4KYPA 5KK4A 1FH3A 1T1TA 2KYQA 1C56A 2LR3A 1PTXA 1I2VA 1PE4A 2E3FA 1LQIA 1ZVEA 2BRZA 1NH5A 2KBJA 1BMRA 1ZU3A 1I6GA 1JKZA 1CN2A 1BCGA 1CHZA 1OZZA 1SEGA 2B68A 2KJAA 2LY5A 1NRBA 2A7TA 1DJTA 2GL1A 1B7DA 1I2UA 4V1DC 4AEIA 1VNBA 1P00A 1MR4A 2M8BB 2E0HA 1GPSA 1NRAA 4HE7A 1SNBA 1AYJA 1P0AA 1VNAA 1N4NA 2YEOA 1B3CA 1T7AA 1DQ7A 1ZUTA 1PX9A 2E3GA 1OMYA 1C55A 1WMTA 2NY9X 2LJ7A 1LQQA 2ASCA 1KV0A 2LKBA 2MZ0A 1BK8A 1L4VA 2KSKA 1JZAA 1ZVGA 1WWNA 2ATBA 1ZFUA 1MYNA 3PSMA 1LQHA 2LT8A
chains in the Genus database with same CATH superfamily
4H5WA 3CQXA 1T0ZA 1NGAA 2N69A 1WT7A 2YBRC 2LY6A 1AHOA 1SN4A 2KBKA 5AQFA 3QFUA 2NY8X 2QWLA 3IUCA 2KHOA 3QMLA 1T7BA 2N2QA 5AQNA 2QXLA 2N2RA 3FZMA 2LI7A 3KVGA 2KPYA 4AB0A 1NGJA 3LDQA 3R2VA 1JXCA 2JDQD 3E7RL 1ICAA 2I61A 4HWIA 5AQLA 1NGFA 3D2FB 3I33A 1BRZA 1JZBA 1NGHA 2YIPA 5AQXA 5CY0A 3L6QA 1T7EA 5FPDA 3A8YA 5EXWA 2SN3A 1BUPA 2LJMA 2YC1C 3HSCA 1ZYVA 2B3CA 4H5VA 4AAZA 5BPMA 2KGQA 4UADE 1NPIA 1UGLA 1ZYWA 2QWRA 3CW4A 1I6FA 4HHFA 4UJ0A 2VY6A 5AQMA 3KC6A 5F1XA 2V7ZA 1SN1A 2QW9A 4H5TA 1TI5A 4CQKA 1GPTA 1KAYA 3BK3C 3C7NA 1NE5A 2N66A 2KBHA 3ATUA 3E7UX 1ATSA 4KYPA 3M3ZA 5KK4A 1FH3A 1T1TA 2KYQA 1C56A 5AQUA 2LR3A 2MN5A 1PTXA 5BPLA 2D56A 1I2VA 1PE4A 1ATRA 2E3FA 1LQIA 5AQOA 1BA0A 1ZVEA 2BRZA 4FL9A 1NGGA 3L56A 5FPMA 1NH5A 2KBJA 1BMRA 1ZU3A 1I6GA 1NGIA 5FPNA 3LDPA 3L4IA 4H5RA 1JKZA 1CN2A 1BCGA 5EX5A 1CHZA 2YILA 1KAZA 2QWNA 2GMOA 1YUWA 1NGCA 5AQRA 3D2EA 2YIOA 1OZZA 4H5NA 3FZFA 1SEGA 2QWQA 1HX1A 2B68A 5AQTA 1XRSB 2KJAA 2LY5A 1NGBA 1NRBA 3GKUA 2A7TA 1DJTA 2GL1A 5BN9A 3FZLA 5FPEA 5AQQA 3QFPA 3QI7A 1B7DA 5AQHA 1I2UA 1BA1A 4V1DC 3LDNA 1VNBA 4IO8A 5AQKA 4AEIA 3KP1A 1KAXA 1P00A 1QQNA 1MR4A 3KOYA 5AQZA 1HJOA 5EVZA 3FZKA 5AQVA 2M8BB 5BPNA 2E0HA 3KOXA 1NRAA 3LDLA 5AQPA 4HE7A 1GPSA 1NGDA 1SNBA 1AYJA 1P0AA 1VNAA 5F0XA 3D2FA 4KBOA 5AR0A 1N4NA 3KHWA 2YEOA 2K35A 3LDOA 2QWPA 1QQOA 1B3CA 1T7AA 5AQWA 1DQ7A 1ZUTA 2QWMA 5AQJA 3ATVA 1PX9A 2E2FA 1OMYA 2E3GA 2E8AA 1QQMA 2MBKA 3GDQA 1C55A 1WMTA 2NY9X 4FSVA 2G2KA 2LJ7A 3C7NB 3FZHA 1LQQA 2E88A 5AQIA 2ASCA 5AQGA 3KP0A 2QWOA 4GNIA 1DKGD 1S3XA 3SF4D 1KV0A 1NGEA 1POIA 2LKBA 5EY4A 2MZ0A 3KOWA 1BK8A 1L4VA 2LN8A 2KSKA 4UAEF 1JZAA 1ZVGA 1HPMA 3GL1A 5AQSA 3AY9A 1WWNA 2ATBA 2BUPA 5BN8A 1ZFUA 1MYNA 3JXUA 3KOZA 3PSMA 1K8BA 3FE1A 5F2RA 3D2EB 4UAFE 5AQYA 1LQHA 2LT8A
chains in the Genus database with same CATH topology
1T0ZA 2N69A 1WT7A 2YBRC 2LY6A 1AHOA 1SN4A 2KBKA 2NY8X 1T7BA 2N2QA 2N2RA 2LI7A 4AB0A 2KPYA 1JXCA 3E7RL 1ICAA 2I61A 1BRZA 1JZBA 5CY0A 1T7EA 2SN3A 2LJMA 2YC1C 1ZYVA 2B3CA 4AAZA 2KGQA 1NPIA 1ZYWA 1I6FA 4HHFA 4UJ0A 1SN1A 1TI5A 4CQKA 1GPTA 1NE5A 2N66A 2KBHA 3E7UX 4KYPA 5KK4A 1FH3A 1T1TA 2KYQA 1C56A 2LR3A 1PTXA 1I2VA 1PE4A 2E3FA 1LQIA 1ZVEA 2BRZA 1NH5A 2KBJA 1BMRA 1ZU3A 1I6GA 1JKZA 1CN2A 1BCGA 1CHZA 1OZZA 1SEGA 2B68A 2KJAA 2LY5A 1NRBA 2A7TA 1DJTA 2GL1A 1B7DA 1I2UA 4V1DC 4AEIA 1VNBA 1P00A 1MR4A 2M8BB 2E0HA 1GPSA 1NRAA 4HE7A 1SNBA 1AYJA 1P0AA 1VNAA 1N4NA 2YEOA 1B3CA 1T7AA 1DQ7A 1ZUTA 1PX9A 2E3GA 1OMYA 1C55A 1WMTA 2NY9X 2LJ7A 1LQQA 2ASCA 1KV0A 2LKBA 2MZ0A 1BK8A 1L4VA 2KSKA 1JZAA 1ZVGA 1WWNA 2ATBA 1ZFUA 1MYNA 3PSMA 1LQHA 2LT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0Z A;  2N69 A;  1WT7 A;  2YBR C;  2LY6 A;  1AHO A;  1SN4 A;  2KBK A;  2NY8 X;  1T7B A;  2N2Q A;  2N2R A;  2LI7 A;  4AB0 A;  2KPY A;  1JXC A;  3E7R L;  1ICA A;  2I61 A;  1BRZ A;  1JZB A;  5CY0 A;  1T7E A;  2SN3 A;  2LJM A;  2YC1 C;  1ZYV A;  2B3C A;  4AAZ A;  2KGQ A;  1NPI A;  1ZYW A;  1I6F A;  4HHF A;  4UJ0 A;  1SN1 A;  1TI5 A;  4CQK A;  1GPT A;  1NE5 A;  2N66 A;  2KBH A;  3E7U X;  4KYP A;  5KK4 A;  1FH3 A;  1T1T A;  2KYQ A;  1C56 A;  2LR3 A;  1PTX A;  1I2V A;  1PE4 A;  2E3F A;  1LQI A;  1ZVE A;  2BRZ A;  1NH5 A;  2KBJ A;  1BMR A;  1ZU3 A;  1I6G A;  1JKZ A;  1CN2 A;  1BCG A;  1CHZ A;  1OZZ A;  1SEG A;  2B68 A;  2KJA A;  2LY5 A;  1NRB A;  2A7T A;  1DJT A;  2GL1 A;  1B7D A;  1I2U A;  4V1D C;  4AEI A;  1VNB A;  1P00 A;  1MR4 A;  2M8B B;  2E0H A;  1GPS A;  1NRA A;  4HE7 A;  1SNB A;  1AYJ A;  1P0A A;  1VNA A;  1N4N A;  2YEO A;  1B3C A;  1T7A A;  1DQ7 A;  1ZUT A;  1PX9 A;  2E3G A;  1OMY A;  1C55 A;  1WMT A;  2NY9 X;  2LJ7 A;  1LQQ A;  2ASC A;  1KV0 A;  2LKB A;  2MZ0 A;  1BK8 A;  1L4V A;  2KSK A;  1JZA A;  1ZVG A;  1WWN A;  2ATB A;  1ZFU A;  1MYN A;  3PSM A;  1LQH A;  2LT8 A; 
#chains in the Genus database with same CATH topology
 4H5W A;  3CQX A;  1T0Z A;  1NGA A;  2N69 A;  1WT7 A;  2YBR C;  2LY6 A;  1AHO A;  1SN4 A;  2KBK A;  5AQF A;  3QFU A;  2NY8 X;  2QWL A;  3IUC A;  2KHO A;  3QML A;  1T7B A;  2N2Q A;  5AQN A;  2QXL A;  2N2R A;  3FZM A;  2LI7 A;  3KVG A;  2KPY A;  4AB0 A;  1NGJ A;  3LDQ A;  3R2V A;  1JXC A;  2JDQ D;  3E7R L;  1ICA A;  2I61 A;  4HWI A;  5AQL A;  1NGF A;  3D2F B;  3I33 A;  1BRZ A;  1JZB A;  1NGH A;  2YIP A;  5AQX A;  5CY0 A;  3L6Q A;  1T7E A;  5FPD A;  3A8Y A;  5EXW A;  2SN3 A;  1BUP A;  2LJM A;  2YC1 C;  3HSC A;  1ZYV A;  2B3C A;  4H5V A;  4AAZ A;  5BPM A;  2KGQ A;  4UAD E;  1NPI A;  1UGL A;  1ZYW A;  2QWR A;  3CW4 A;  1I6F A;  4HHF A;  4UJ0 A;  2VY6 A;  5AQM A;  3KC6 A;  5F1X A;  2V7Z A;  1SN1 A;  2QW9 A;  4H5T A;  1TI5 A;  4CQK A;  1GPT A;  1KAY A;  3BK3 C;  3C7N A;  1NE5 A;  2N66 A;  2KBH A;  3ATU A;  3E7U X;  1ATS A;  4KYP A;  3M3Z A;  5KK4 A;  1FH3 A;  1T1T A;  2KYQ A;  1C56 A;  5AQU A;  2LR3 A;  2MN5 A;  1PTX A;  5BPL A;  2D56 A;  1I2V A;  1PE4 A;  1ATR A;  2E3F A;  1LQI A;  5AQO A;  1BA0 A;  1ZVE A;  2BRZ A;  4FL9 A;  1NGG A;  3L56 A;  5FPM A;  1NH5 A;  2KBJ A;  1BMR A;  1ZU3 A;  1I6G A;  1NGI A;  5FPN A;  3LDP A;  3L4I A;  4H5R A;  1JKZ A;  1CN2 A;  1BCG A;  5EX5 A;  1CHZ A;  2YIL A;  1KAZ A;  2QWN A;  2GMO A;  1YUW A;  1NGC A;  5AQR A;  3D2E A;  2YIO A;  1OZZ A;  4H5N A;  3FZF A;  1SEG A;  2QWQ A;  1HX1 A;  2B68 A;  5AQT A;  1XRS B;  2KJA A;  2LY5 A;  1NGB A;  1NRB A;  3GKU A;  2A7T A;  1DJT A;  2GL1 A;  5BN9 A;  3FZL A;  5FPE A;  5AQQ A;  3QFP A;  3QI7 A;  1B7D A;  5AQH A;  1I2U A;  1BA1 A;  4V1D C;  3LDN A;  1VNB A;  4IO8 A;  5AQK A;  4AEI A;  3KP1 A;  1KAX A;  1P00 A;  1QQN A;  1MR4 A;  3KOY A;  5AQZ A;  1HJO A;  5EVZ A;  3FZK A;  5AQV A;  2M8B B;  5BPN A;  2E0H A;  3KOX A;  1NRA A;  3LDL A;  5AQP A;  4HE7 A;  1GPS A;  1NGD A;  1SNB A;  1AYJ A;  1P0A A;  1VNA A;  5F0X A;  3D2F A;  4KBO A;  5AR0 A;  1N4N A;  3KHW A;  2YEO A;  2K35 A;  3LDO A;  2QWP A;  1QQO A;  1B3C A;  1T7A A;  5AQW A;  1DQ7 A;  1ZUT A;  2QWM A;  5AQJ A;  3ATV A;  1PX9 A;  2E2F A;  1OMY A;  2E3G A;  2E8A A;  1QQM A;  2MBK A;  3GDQ A;  1C55 A;  1WMT A;  2NY9 X;  4FSV A;  2G2K A;  2LJ7 A;  3C7N B;  3FZH A;  1LQQ A;  2E88 A;  5AQI A;  2ASC A;  5AQG A;  3KP0 A;  2QWO A;  4GNI A;  1DKG D;  1S3X A;  3SF4 D;  1KV0 A;  1NGE A;  1POI A;  2LKB A;  5EY4 A;  2MZ0 A;  3KOW A;  1BK8 A;  1L4V A;  2LN8 A;  2KSK A;  4UAE F;  1JZA A;  1ZVG A;  1HPM A;  3GL1 A;  5AQS A;  3AY9 A;  1WWN A;  2ATB A;  2BUP A;  5BN8 A;  1ZFU A;  1MYN A;  3JXU A;  3KOZ A;  3PSM A;  1K8B A;  3FE1 A;  5F2R A;  3D2E B;  4UAF E;  5AQY A;  1LQH A;  2LT8 A; 
#chains in the Genus database with same CATH homology
 1T0Z A;  2N69 A;  1WT7 A;  2YBR C;  2LY6 A;  1AHO A;  1SN4 A;  2KBK A;  2NY8 X;  1T7B A;  2N2Q A;  2N2R A;  2LI7 A;  4AB0 A;  2KPY A;  1JXC A;  3E7R L;  1ICA A;  2I61 A;  1BRZ A;  1JZB A;  5CY0 A;  1T7E A;  2SN3 A;  2LJM A;  2YC1 C;  1ZYV A;  2B3C A;  4AAZ A;  2KGQ A;  1NPI A;  1ZYW A;  1I6F A;  4HHF A;  4UJ0 A;  1SN1 A;  1TI5 A;  4CQK A;  1GPT A;  1NE5 A;  2N66 A;  2KBH A;  3E7U X;  4KYP A;  5KK4 A;  1FH3 A;  1T1T A;  2KYQ A;  1C56 A;  2LR3 A;  1PTX A;  1I2V A;  1PE4 A;  2E3F A;  1LQI A;  1ZVE A;  2BRZ A;  1NH5 A;  2KBJ A;  1BMR A;  1ZU3 A;  1I6G A;  1JKZ A;  1CN2 A;  1BCG A;  1CHZ A;  1OZZ A;  1SEG A;  2B68 A;  2KJA A;  2LY5 A;  1NRB A;  2A7T A;  1DJT A;  2GL1 A;  1B7D A;  1I2U A;  4V1D C;  4AEI A;  1VNB A;  1P00 A;  1MR4 A;  2M8B B;  2E0H A;  1GPS A;  1NRA A;  4HE7 A;  1SNB A;  1AYJ A;  1P0A A;  1VNA A;  1N4N A;  2YEO A;  1B3C A;  1T7A A;  1DQ7 A;  1ZUT A;  1PX9 A;  2E3G A;  1OMY A;  1C55 A;  1WMT A;  2NY9 X;  2LJ7 A;  1LQQ A;  2ASC A;  1KV0 A;  2LKB A;  2MZ0 A;  1BK8 A;  1L4V A;  2KSK A;  1JZA A;  1ZVG A;  1WWN A;  2ATB A;  1ZFU A;  1MYN A;  3PSM A;  1LQH A;  2LT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...