1I2VA

Nmr solution structures of an antifungal and antibacterial mutant of heliomicin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
44
structure length
44
Chain Sequence
b'DKLIGSCVWGAVNYTSDCNGECLLRGYKGGHCGSFANVNCWCET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEFENSIN HELIOMICIN
publication title Solution structures of the antifungal heliomicin and a selected variant with both antibacterial and antifungal activities.
pubmed doi rcsb
source organism Heliothis virescens
molecule tags Antimicrobial protein
total genus 8
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2001-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1i2vA00
1I6GA 4HE7A 2YBRC 1NRAA 1BMRA 1P0AA 2B68A 1VNAA 1SN4A 1GPTA 2GL1A 2N2RA 2KBJA 1KV0A 2LR3A 2E3FA 3E7RL 5CY0A 2M8BB 1MR4A 2BRZA 1FH3A 1BRZA 1SN1A 2KBKA 1T7AA 1LQIA 1TI5A 1OZZA 3PSMA 1MYNA 1I2UA 2E0HA 1NPIA 1JZBA 1I6FA 1PTXA 2KPYA 2KBHA 1DQ7A 1NRBA 2ATBA 1ZFUA 1B3CA 3E7UX 1WWNA 1SEGA 2LY5A 1ZUTA 1CN2A 1GPSA 1PX9A 1B7DA 4HHFA 2N69A 1JXCA 1SNBA 4CQKA 1JZAA 2I61A 1JKZA 2LY6A 1PE4A 2N2QA 1L4VA 1ZVEA 2LJ7A 2SN3A 2KJAA 1WMTA 1BK8A 2KSKA 2KGQA 1ZVGA 2YC1C 1ICAA 2ASCA 4KYPA 1AHOA 2KYQA 2E3GA 4V1DC 1P00A 1T1TA 1ZU3A 1T0ZA 2MZ0A 1LQHA 1T7BA 1T7EA 1ZYVA 5KK4A 1AYJA 1CHZA 1OMYA 1ZYWA 1WT7A 1NH5A 1DJTA 1I2VA 1BCGA 1N4NA 2NY9X 2LKBA 1C55A 2NY8X 4UJ0A 2A7TA 1VNBA 1C56A 4AAZA 1NE5A 2N66A 1LQQA 2B3CA 2LT8A 4AEIA 4AB0A 2YEOA 2LI7A 2LJMA
chains in the Genus database with same CATH superfamily
3JXUA 3LDLA 1I6GA 4HE7A 1QQNA 2YBRC 3KVGA 1NRAA 3M3ZA 5AQKA 5FPNA 4UAEF 2QWNA 1P0AA 2B68A 3L6QA 1BMRA 1VNAA 5F0XA 3QMLA 1SN4A 1GPTA 2GL1A 2N2RA 2KBJA 4IO8A 3C7NA 4H5VA 1KV0A 3SF4D 2LR3A 3KHWA 5F1XA 2E3FA 1NGHA 5AR0A 5AQTA 3E7RL 1XRSB 1NGCA 1POIA 3CW4A 4HWIA 5AQLA 4FL9A 3D2FA 5BN9A 5CY0A 2M8BB 1MR4A 1NGBA 1QQOA 5AQMA 5EVZA 2BRZA 3D2EA 4GNIA 1FH3A 1DKGD 1BRZA 3LDNA 1SN1A 2KBKA 1T7AA 2D56A 2E88A 5F2RA 1LQIA 1TI5A 3L4IA 1OZZA 3I33A 3PSMA 1MYNA 3BK3C 1I2UA 2E0HA 1NPIA 1JZBA 1HX1A 1I6FA 1PTXA 2KPYA 2KBHA 1DQ7A 1NRBA 2ATBA 2QWRA 1BUPA 1ZFUA 1B3CA 5BPMA 3E7UX 5FPMA 1HJOA 1WWNA 1SEGA 3KOWA 3KP1A 4UADE 2LY5A 5AQPA 1NGJA 1ZUTA 3C7NB 2QW9A 1CN2A 1GPSA 1PX9A 2MBKA 5AQHA 5AQRA 4H5WA 2JDQD 2QWMA 5AQWA 3LDQA 1B7DA 4HHFA 3D2FB 5BPNA 2E8AA 1JXCA 2N69A 3KOYA 3KOXA 3QFPA 5AQVA 2BUPA 1SNBA 1BA1A 3FZKA 3ATUA 1NGFA 3D2EB 3LDPA 4CQKA 1JZAA 1NGDA 2VY6A 5EXWA 2I61A 3LDOA 2QWLA 2LY6A 5AQJA 1JKZA 2G2KA 1PE4A 5AQZA 3GKUA 5FPDA 2N2QA 2YIOA 3FZFA 3IUCA 1NGAA 1ZVEA 2V7ZA 1L4VA 3CQXA 1HPMA 3HSCA 2LJ7A 2SN3A 2KJAA 3FZLA 4H5TA 3QI7A 1WMTA 3FZHA 3KOZA 1BK8A 1ATSA 3QFUA 2KSKA 1NGIA 1S3XA 4KBOA 1UGLA 5AQIA 2KGQA 1ZVGA 2YC1C 1ICAA 5BPLA 1KAZA 3A8YA 2ASCA 4KYPA 1AHOA 2E2FA 2E3GA 2GMOA 2KYQA 4V1DC 2QXLA 1P00A 1T1TA 1ZU3A 1T0ZA 2MZ0A 1NGEA 2QWQA 2MN5A 4UAFE 1LQHA 1BA0A 4H5NA 1T7BA 1T7EA 1ZYVA 3R2VA 5KK4A 1AYJA 1CHZA 1OMYA 3L56A 5AQNA 1ZYWA 5FPEA 1WT7A 5AQYA 5BN8A 3GL1A 3GDQA 1NGGA 1NH5A 1K8BA 5AQGA 1DJTA 2KHOA 5AQQA 1I2VA 1BCGA 1N4NA 2K35A 2LKBA 2NY9X 1QQMA 4H5RA 5AQOA 2NY8X 5AQSA 1C55A 3KP0A 4UJ0A 2A7TA 2LN8A 1VNBA 1YUWA 3ATVA 1C56A 1ATRA 2QWOA 4FSVA 5AQXA 3KC6A 1NE5A 5EY4A 5EX5A 4AAZA 2N66A 2QWPA 2YIPA 1KAYA 5AQUA 3AY9A 5AQFA 1LQQA 2B3CA 3FE1A 2LT8A 2YILA 4AB0A 4AEIA 1KAXA 3FZMA 2YEOA 2LI7A 2LJMA
chains in the Genus database with same CATH topology
1I6GA 4HE7A 2YBRC 1NRAA 1BMRA 1P0AA 2B68A 1VNAA 1SN4A 1GPTA 2GL1A 2N2RA 2KBJA 1KV0A 2LR3A 2E3FA 3E7RL 5CY0A 2M8BB 1MR4A 2BRZA 1FH3A 1BRZA 1SN1A 2KBKA 1T7AA 1LQIA 1TI5A 1OZZA 3PSMA 1MYNA 1I2UA 2E0HA 1NPIA 1JZBA 1I6FA 1PTXA 2KPYA 2KBHA 1DQ7A 1NRBA 2ATBA 1ZFUA 1B3CA 3E7UX 1WWNA 1SEGA 2LY5A 1ZUTA 1CN2A 1GPSA 1PX9A 1B7DA 4HHFA 2N69A 1JXCA 1SNBA 4CQKA 1JZAA 2I61A 1JKZA 2LY6A 1PE4A 2N2QA 1L4VA 1ZVEA 2LJ7A 2SN3A 2KJAA 1WMTA 1BK8A 2KSKA 2KGQA 1ZVGA 2YC1C 1ICAA 2ASCA 4KYPA 1AHOA 2KYQA 2E3GA 4V1DC 1P00A 1T1TA 1ZU3A 1T0ZA 2MZ0A 1LQHA 1T7BA 1T7EA 1ZYVA 5KK4A 1AYJA 1CHZA 1OMYA 1ZYWA 1WT7A 1NH5A 1DJTA 1I2VA 1BCGA 1N4NA 2NY9X 2LKBA 1C55A 2NY8X 4UJ0A 2A7TA 1VNBA 1C56A 4AAZA 1NE5A 2N66A 1LQQA 2B3CA 2LT8A 4AEIA 4AB0A 2YEOA 2LI7A 2LJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6G A;  4HE7 A;  2YBR C;  1NRA A;  1BMR A;  1P0A A;  2B68 A;  1VNA A;  1SN4 A;  1GPT A;  2GL1 A;  2N2R A;  2KBJ A;  1KV0 A;  2LR3 A;  2E3F A;  3E7R L;  5CY0 A;  2M8B B;  1MR4 A;  2BRZ A;  1FH3 A;  1BRZ A;  1SN1 A;  2KBK A;  1T7A A;  1LQI A;  1TI5 A;  1OZZ A;  3PSM A;  1MYN A;  1I2U A;  2E0H A;  1NPI A;  1JZB A;  1I6F A;  1PTX A;  2KPY A;  2KBH A;  1DQ7 A;  1NRB A;  2ATB A;  1ZFU A;  1B3C A;  3E7U X;  1WWN A;  1SEG A;  2LY5 A;  1ZUT A;  1CN2 A;  1GPS A;  1PX9 A;  1B7D A;  4HHF A;  2N69 A;  1JXC A;  1SNB A;  4CQK A;  1JZA A;  2I61 A;  1JKZ A;  2LY6 A;  1PE4 A;  2N2Q A;  1L4V A;  1ZVE A;  2LJ7 A;  2SN3 A;  2KJA A;  1WMT A;  1BK8 A;  2KSK A;  2KGQ A;  1ZVG A;  2YC1 C;  1ICA A;  2ASC A;  4KYP A;  1AHO A;  2KYQ A;  2E3G A;  4V1D C;  1P00 A;  1T1T A;  1ZU3 A;  1T0Z A;  2MZ0 A;  1LQH A;  1T7B A;  1T7E A;  1ZYV A;  5KK4 A;  1AYJ A;  1CHZ A;  1OMY A;  1ZYW A;  1WT7 A;  1NH5 A;  1DJT A;  1I2V A;  1BCG A;  1N4N A;  2NY9 X;  2LKB A;  1C55 A;  2NY8 X;  4UJ0 A;  2A7T A;  1VNB A;  1C56 A;  4AAZ A;  1NE5 A;  2N66 A;  1LQQ A;  2B3C A;  2LT8 A;  4AEI A;  4AB0 A;  2YEO A;  2LI7 A;  2LJM A; 
#chains in the Genus database with same CATH topology
 3JXU A;  3LDL A;  1I6G A;  4HE7 A;  1QQN A;  2YBR C;  3KVG A;  1NRA A;  3M3Z A;  5AQK A;  5FPN A;  4UAE F;  2QWN A;  1P0A A;  2B68 A;  3L6Q A;  1BMR A;  1VNA A;  5F0X A;  3QML A;  1SN4 A;  1GPT A;  2GL1 A;  2N2R A;  2KBJ A;  4IO8 A;  3C7N A;  4H5V A;  1KV0 A;  3SF4 D;  2LR3 A;  3KHW A;  5F1X A;  2E3F A;  1NGH A;  5AR0 A;  5AQT A;  3E7R L;  1XRS B;  1NGC A;  1POI A;  3CW4 A;  4HWI A;  5AQL A;  4FL9 A;  3D2F A;  5BN9 A;  5CY0 A;  2M8B B;  1MR4 A;  1NGB A;  1QQO A;  5AQM A;  5EVZ A;  2BRZ A;  3D2E A;  4GNI A;  1FH3 A;  1DKG D;  1BRZ A;  3LDN A;  1SN1 A;  2KBK A;  1T7A A;  2D56 A;  2E88 A;  5F2R A;  1LQI A;  1TI5 A;  3L4I A;  1OZZ A;  3I33 A;  3PSM A;  1MYN A;  3BK3 C;  1I2U A;  2E0H A;  1NPI A;  1JZB A;  1HX1 A;  1I6F A;  1PTX A;  2KPY A;  2KBH A;  1DQ7 A;  1NRB A;  2ATB A;  2QWR A;  1BUP A;  1ZFU A;  1B3C A;  5BPM A;  3E7U X;  5FPM A;  1HJO A;  1WWN A;  1SEG A;  3KOW A;  3KP1 A;  4UAD E;  2LY5 A;  5AQP A;  1NGJ A;  1ZUT A;  3C7N B;  2QW9 A;  1CN2 A;  1GPS A;  1PX9 A;  2MBK A;  5AQH A;  5AQR A;  4H5W A;  2JDQ D;  2QWM A;  5AQW A;  3LDQ A;  1B7D A;  4HHF A;  3D2F B;  5BPN A;  2E8A A;  1JXC A;  2N69 A;  3KOY A;  3KOX A;  3QFP A;  5AQV A;  2BUP A;  1SNB A;  1BA1 A;  3FZK A;  3ATU A;  1NGF A;  3D2E B;  3LDP A;  4CQK A;  1JZA A;  1NGD A;  2VY6 A;  5EXW A;  2I61 A;  3LDO A;  2QWL A;  2LY6 A;  5AQJ A;  1JKZ A;  2G2K A;  1PE4 A;  5AQZ A;  3GKU A;  5FPD A;  2N2Q A;  2YIO A;  3FZF A;  3IUC A;  1NGA A;  1ZVE A;  2V7Z A;  1L4V A;  3CQX A;  1HPM A;  3HSC A;  2LJ7 A;  2SN3 A;  2KJA A;  3FZL A;  4H5T A;  3QI7 A;  1WMT A;  3FZH A;  3KOZ A;  1BK8 A;  1ATS A;  3QFU A;  2KSK A;  1NGI A;  1S3X A;  4KBO A;  1UGL A;  5AQI A;  2KGQ A;  1ZVG A;  2YC1 C;  1ICA A;  5BPL A;  1KAZ A;  3A8Y A;  2ASC A;  4KYP A;  1AHO A;  2E2F A;  2E3G A;  2GMO A;  2KYQ A;  4V1D C;  2QXL A;  1P00 A;  1T1T A;  1ZU3 A;  1T0Z A;  2MZ0 A;  1NGE A;  2QWQ A;  2MN5 A;  4UAF E;  1LQH A;  1BA0 A;  4H5N A;  1T7B A;  1T7E A;  1ZYV A;  3R2V A;  5KK4 A;  1AYJ A;  1CHZ A;  1OMY A;  3L56 A;  5AQN A;  1ZYW A;  5FPE A;  1WT7 A;  5AQY A;  5BN8 A;  3GL1 A;  3GDQ A;  1NGG A;  1NH5 A;  1K8B A;  5AQG A;  1DJT A;  2KHO A;  5AQQ A;  1I2V A;  1BCG A;  1N4N A;  2K35 A;  2LKB A;  2NY9 X;  1QQM A;  4H5R A;  5AQO A;  2NY8 X;  5AQS A;  1C55 A;  3KP0 A;  4UJ0 A;  2A7T A;  2LN8 A;  1VNB A;  1YUW A;  3ATV A;  1C56 A;  1ATR A;  2QWO A;  4FSV A;  5AQX A;  3KC6 A;  1NE5 A;  5EY4 A;  5EX5 A;  4AAZ A;  2N66 A;  2QWP A;  2YIP A;  1KAY A;  5AQU A;  3AY9 A;  5AQF A;  1LQQ A;  2B3C A;  3FE1 A;  2LT8 A;  2YIL A;  4AB0 A;  4AEI A;  1KAX A;  3FZM A;  2YEO A;  2LI7 A;  2LJM A; 
#chains in the Genus database with same CATH homology
 1I6G A;  4HE7 A;  2YBR C;  1NRA A;  1BMR A;  1P0A A;  2B68 A;  1VNA A;  1SN4 A;  1GPT A;  2GL1 A;  2N2R A;  2KBJ A;  1KV0 A;  2LR3 A;  2E3F A;  3E7R L;  5CY0 A;  2M8B B;  1MR4 A;  2BRZ A;  1FH3 A;  1BRZ A;  1SN1 A;  2KBK A;  1T7A A;  1LQI A;  1TI5 A;  1OZZ A;  3PSM A;  1MYN A;  1I2U A;  2E0H A;  1NPI A;  1JZB A;  1I6F A;  1PTX A;  2KPY A;  2KBH A;  1DQ7 A;  1NRB A;  2ATB A;  1ZFU A;  1B3C A;  3E7U X;  1WWN A;  1SEG A;  2LY5 A;  1ZUT A;  1CN2 A;  1GPS A;  1PX9 A;  1B7D A;  4HHF A;  2N69 A;  1JXC A;  1SNB A;  4CQK A;  1JZA A;  2I61 A;  1JKZ A;  2LY6 A;  1PE4 A;  2N2Q A;  1L4V A;  1ZVE A;  2LJ7 A;  2SN3 A;  2KJA A;  1WMT A;  1BK8 A;  2KSK A;  2KGQ A;  1ZVG A;  2YC1 C;  1ICA A;  2ASC A;  4KYP A;  1AHO A;  2KYQ A;  2E3G A;  4V1D C;  1P00 A;  1T1T A;  1ZU3 A;  1T0Z A;  2MZ0 A;  1LQH A;  1T7B A;  1T7E A;  1ZYV A;  5KK4 A;  1AYJ A;  1CHZ A;  1OMY A;  1ZYW A;  1WT7 A;  1NH5 A;  1DJT A;  1I2V A;  1BCG A;  1N4N A;  2NY9 X;  2LKB A;  1C55 A;  2NY8 X;  4UJ0 A;  2A7T A;  1VNB A;  1C56 A;  4AAZ A;  1NE5 A;  2N66 A;  1LQQ A;  2B3C A;  2LT8 A;  4AEI A;  4AB0 A;  2YEO A;  2LI7 A;  2LJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...