1I2VA

Nmr solution structures of an antifungal and antibacterial mutant of heliomicin
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
44
structure length
44
Chain Sequence
DKLIGSCVWGAVNYTSDCNGECLLRGYKGGHCGSFANVNCWCET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords DEFENSIN HELIOMICIN
publication title Solution structures of the antifungal heliomicin and a selected variant with both antibacterial and antifungal activities.
pubmed doi rcsb
source organism Heliothis virescens
total genus 8
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2001-02-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1i2vA00
1LQHA 1ZVGA 1OZZA 1ZVEA 1WMTA 1VNBA 1GPSA 3E7UX 1PX9A 1PE4A 1SEGA 1NH5A 2KJAA 1GPTA 1BK8A 4HHFA 1B7DA 2B68A 1SN4A 2MZ0A 1B3CA 1PTXA 2LI7A 1JZBA 1LQIA 1FH3A 1DQ7A 1NRBA 4AB0A 1T7BA 2NY9X 2NY8X 2LY5A 1P0AA 2N69A 2KBJA 1C55A 1ZYWA 1BRZA 1MYNA 2LT8A 1ICAA 3E7RL 1TI5A 1T0ZA 1I2VA 5CY0A 1I6GA 1JKZA 1AHOA 2YBRC 1C56A 4UJ0A 2E0HA 1T7EA 2E3GA 5KK4A 4KYPA 2N66A 1SNBA 2LKBA 1AYJA 2N2RA 1WWNA 2KYQA 1DJTA 1JZAA 2A7TA 2KGQA 1LQQA 2LJMA 4AAZA 3PSMA 2YEOA 4HE7A 1BMRA 1L4VA 2LR3A 1CHZA 2KBHA 2B3CA 1P00A 1BCGA 2N2QA 1MR4A 1VNAA 2ATBA 4AEIA 2M8BB 1T1TA 1JXCA 1ZYVA 1T7AA 4V1DC 1OMYA 1I2UA 1I6FA 1NPIA 1CN2A 2BRZA 1ZFUA 1SN1A 4CQKA 2GL1A 2I61A 1N4NA 1ZU3A 1WT7A 2LY6A 2E3FA 2YC1C 1NRAA 2LJ7A 1NE5A 2KBKA 1ZUTA 2KSKA 2ASCA 1KV0A 2SN3A 2KPYA
chains in the Genus database with same CATH superfamily
1LQHA 1ZVGA 3KVGA 3L4IA 1OZZA 1NGIA 1S3XA 3AY9A 1ZVEA 1WMTA 1VNBA 3KC6A 1NGGA 3KOYA 3FZFA 5AQTA 1POIA 3KOXA 3QFUA 5FPMA 1NGBA 1PX9A 2VY6A 3E7UX 1GPSA 1NGJA 2QWQA 2QWLA 3ATUA 1K8BA 1PE4A 3C7NA 1SEGA 1BA0A 1NH5A 3I33A 2KJAA 5BPMA 2JDQD 2MBKA 3LDOA 3M3ZA 5AQYA 1GPTA 1BK8A 5AQRA 3FZKA 2G2KA 3KP0A 4HHFA 5AQKA 3ATVA 5AQWA 2BUPA 3GKUA 1B7DA 2B68A 5AQUA 1SN4A 3L6QA 2MZ0A 2QWNA 5AR0A 1HJOA 2YILA 1B3CA 1PTXA 2LI7A 1NGCA 2D56A 3LDNA 1JZBA 3D2EA 1LQIA 1NGEA 2QWRA 1DQ7A 2YIOA 5AQJA 1FH3A 1NRBA 4AB0A 5F1XA 1T7BA 2NY9X 1BUPA 2NY8X 2LY5A 2LN8A 2QWMA 1P0AA 4H5VA 5FPEA 3QMLA 2N69A 5AQSA 3HSCA 5AQFA 2KBJA 1C55A 5AQLA 1ZYWA 4H5RA 1KAYA 1QQMA 1BRZA 1XRSB 1MYNA 2LT8A 5BN9A 3E7RL 5BPNA 1TI5A 1ICAA 1T0ZA 3L56A 1I2VA 3KP1A 5CY0A 4KBOA 1I6GA 3LDPA 1JKZA 2E88A 1AHOA 2YBRC 1DKGD 5AQPA 4FL9A 1C56A 5AQXA 3R2VA 2YIPA 4UJ0A 2E0HA 1NGHA 5BPLA 3C7NB 3A8YA 1T7EA 2E3GA 2GMOA 2QXLA 3FE1A 5KK4A 2K35A 4KYPA 4HWIA 2N66A 1SNBA 3D2FA 2LKBA 3KOWA 5AQIA 5F2RA 1AYJA 1NGFA 1QQNA 2E8AA 2N2RA 1WWNA 2KYQA 5AQVA 1DJTA 1JZAA 2V7ZA 3GDQA 2A7TA 2KGQA 1LQQA 1YUWA 2LJMA 4AAZA 3PSMA 1HX1A 2YEOA 1NGDA 4HE7A 5EXWA 1BMRA 3D2EB 3KHWA 4FSVA 5F0XA 1L4VA 3GL1A 2KHOA 5AQHA 5EX5A 1KAZA 1KAXA 1NGAA 3FZLA 3FZMA 2LR3A 4UAEF 3QI7A 4UAFE 1CHZA 1HPMA 2KBHA 3KOZA 5EVZA 2B3CA 1P00A 1BCGA 2N2QA 1MR4A 3SF4D 4H5WA 1VNAA 2ATBA 5EY4A 4AEIA 2QWPA 3BK3C 3LDQA 2M8BB 5BN8A 1T1TA 1JXCA 1ZYVA 4IO8A 1ATRA 1T7AA 4V1DC 4H5TA 1OMYA 1I2UA 3JXUA 1I6FA 1NPIA 3QFPA 1ATSA 1BA1A 5AQMA 2MN5A 5AQQA 1CN2A 3CQXA 2BRZA 1ZFUA 2QWOA 5FPNA 3FZHA 1SN1A 4CQKA 5FPDA 2GL1A 2I61A 5AQNA 1N4NA 1QQOA 1UGLA 1ZU3A 1WT7A 2LY6A 2E3FA 2YC1C 4GNIA 1NRAA 3D2FB 3LDLA 3IUCA 2LJ7A 5AQGA 1NE5A 2KBKA 2E2FA 4UADE 5AQZA 2QW9A 1ZUTA 2KSKA 2ASCA 3CW4A 1KV0A 2SN3A 5AQOA 4H5NA 2KPYA
chains in the Genus database with same CATH topology
1LQHA 1ZVGA 1OZZA 1ZVEA 1WMTA 1VNBA 1GPSA 3E7UX 1PX9A 1PE4A 1SEGA 1NH5A 2KJAA 1GPTA 1BK8A 4HHFA 1B7DA 2B68A 1SN4A 2MZ0A 1B3CA 1PTXA 2LI7A 1JZBA 1LQIA 1FH3A 1DQ7A 1NRBA 4AB0A 1T7BA 2NY9X 2NY8X 2LY5A 1P0AA 2N69A 2KBJA 1C55A 1ZYWA 1BRZA 1MYNA 2LT8A 1ICAA 3E7RL 1TI5A 1T0ZA 1I2VA 5CY0A 1I6GA 1JKZA 1AHOA 2YBRC 1C56A 4UJ0A 2E0HA 1T7EA 2E3GA 5KK4A 4KYPA 2N66A 1SNBA 2LKBA 1AYJA 2N2RA 1WWNA 2KYQA 1DJTA 1JZAA 2A7TA 2KGQA 1LQQA 2LJMA 4AAZA 3PSMA 2YEOA 4HE7A 1BMRA 1L4VA 2LR3A 1CHZA 2KBHA 2B3CA 1P00A 1BCGA 2N2QA 1MR4A 1VNAA 2ATBA 4AEIA 2M8BB 1T1TA 1JXCA 1ZYVA 1T7AA 4V1DC 1OMYA 1I2UA 1I6FA 1NPIA 1CN2A 2BRZA 1ZFUA 1SN1A 4CQKA 2GL1A 2I61A 1N4NA 1ZU3A 1WT7A 2LY6A 2E3FA 2YC1C 1NRAA 2LJ7A 1NE5A 2KBKA 1ZUTA 2KSKA 2ASCA 1KV0A 2SN3A 2KPYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LQH A;  1ZVG A;  1OZZ A;  1ZVE A;  1WMT A;  1VNB A;  1GPS A;  3E7U X;  1PX9 A;  1PE4 A;  1SEG A;  1NH5 A;  2KJA A;  1GPT A;  1BK8 A;  4HHF A;  1B7D A;  2B68 A;  1SN4 A;  2MZ0 A;  1B3C A;  1PTX A;  2LI7 A;  1JZB A;  1LQI A;  1FH3 A;  1DQ7 A;  1NRB A;  4AB0 A;  1T7B A;  2NY9 X;  2NY8 X;  2LY5 A;  1P0A A;  2N69 A;  2KBJ A;  1C55 A;  1ZYW A;  1BRZ A;  1MYN A;  2LT8 A;  1ICA A;  3E7R L;  1TI5 A;  1T0Z A;  1I2V A;  5CY0 A;  1I6G A;  1JKZ A;  1AHO A;  2YBR C;  1C56 A;  4UJ0 A;  2E0H A;  1T7E A;  2E3G A;  5KK4 A;  4KYP A;  2N66 A;  1SNB A;  2LKB A;  1AYJ A;  2N2R A;  1WWN A;  2KYQ A;  1DJT A;  1JZA A;  2A7T A;  2KGQ A;  1LQQ A;  2LJM A;  4AAZ A;  3PSM A;  2YEO A;  4HE7 A;  1BMR A;  1L4V A;  2LR3 A;  1CHZ A;  2KBH A;  2B3C A;  1P00 A;  1BCG A;  2N2Q A;  1MR4 A;  1VNA A;  2ATB A;  4AEI A;  2M8B B;  1T1T A;  1JXC A;  1ZYV A;  1T7A A;  4V1D C;  1OMY A;  1I2U A;  1I6F A;  1NPI A;  1CN2 A;  2BRZ A;  1ZFU A;  1SN1 A;  4CQK A;  2GL1 A;  2I61 A;  1N4N A;  1ZU3 A;  1WT7 A;  2LY6 A;  2E3F A;  2YC1 C;  1NRA A;  2LJ7 A;  1NE5 A;  2KBK A;  1ZUT A;  2KSK A;  2ASC A;  1KV0 A;  2SN3 A;  2KPY A; 
#chains in the Genus database with same CATH topology
 1LQH A;  1ZVG A;  3KVG A;  3L4I A;  1OZZ A;  1NGI A;  1S3X A;  3AY9 A;  1ZVE A;  1WMT A;  1VNB A;  3KC6 A;  1NGG A;  3KOY A;  3FZF A;  5AQT A;  1POI A;  3KOX A;  3QFU A;  5FPM A;  1NGB A;  1PX9 A;  2VY6 A;  3E7U X;  1GPS A;  1NGJ A;  2QWQ A;  2QWL A;  3ATU A;  1K8B A;  1PE4 A;  3C7N A;  1SEG A;  1BA0 A;  1NH5 A;  3I33 A;  2KJA A;  5BPM A;  2JDQ D;  2MBK A;  3LDO A;  3M3Z A;  5AQY A;  1GPT A;  1BK8 A;  5AQR A;  3FZK A;  2G2K A;  3KP0 A;  4HHF A;  5AQK A;  3ATV A;  5AQW A;  2BUP A;  3GKU A;  1B7D A;  2B68 A;  5AQU A;  1SN4 A;  3L6Q A;  2MZ0 A;  2QWN A;  5AR0 A;  1HJO A;  2YIL A;  1B3C A;  1PTX A;  2LI7 A;  1NGC A;  2D56 A;  3LDN A;  1JZB A;  3D2E A;  1LQI A;  1NGE A;  2QWR A;  1DQ7 A;  2YIO A;  5AQJ A;  1FH3 A;  1NRB A;  4AB0 A;  5F1X A;  1T7B A;  2NY9 X;  1BUP A;  2NY8 X;  2LY5 A;  2LN8 A;  2QWM A;  1P0A A;  4H5V A;  5FPE A;  3QML A;  2N69 A;  5AQS A;  3HSC A;  5AQF A;  2KBJ A;  1C55 A;  5AQL A;  1ZYW A;  4H5R A;  1KAY A;  1QQM A;  1BRZ A;  1XRS B;  1MYN A;  2LT8 A;  5BN9 A;  3E7R L;  5BPN A;  1TI5 A;  1ICA A;  1T0Z A;  3L56 A;  1I2V A;  3KP1 A;  5CY0 A;  4KBO A;  1I6G A;  3LDP A;  1JKZ A;  2E88 A;  1AHO A;  2YBR C;  1DKG D;  5AQP A;  4FL9 A;  1C56 A;  5AQX A;  3R2V A;  2YIP A;  4UJ0 A;  2E0H A;  1NGH A;  5BPL A;  3C7N B;  3A8Y A;  1T7E A;  2E3G A;  2GMO A;  2QXL A;  3FE1 A;  5KK4 A;  2K35 A;  4KYP A;  4HWI A;  2N66 A;  1SNB A;  3D2F A;  2LKB A;  3KOW A;  5AQI A;  5F2R A;  1AYJ A;  1NGF A;  1QQN A;  2E8A A;  2N2R A;  1WWN A;  2KYQ A;  5AQV A;  1DJT A;  1JZA A;  2V7Z A;  3GDQ A;  2A7T A;  2KGQ A;  1LQQ A;  1YUW A;  2LJM A;  4AAZ A;  3PSM A;  1HX1 A;  2YEO A;  1NGD A;  4HE7 A;  5EXW A;  1BMR A;  3D2E B;  3KHW A;  4FSV A;  5F0X A;  1L4V A;  3GL1 A;  2KHO A;  5AQH A;  5EX5 A;  1KAZ A;  1KAX A;  1NGA A;  3FZL A;  3FZM A;  2LR3 A;  4UAE F;  3QI7 A;  4UAF E;  1CHZ A;  1HPM A;  2KBH A;  3KOZ A;  5EVZ A;  2B3C A;  1P00 A;  1BCG A;  2N2Q A;  1MR4 A;  3SF4 D;  4H5W A;  1VNA A;  2ATB A;  5EY4 A;  4AEI A;  2QWP A;  3BK3 C;  3LDQ A;  2M8B B;  5BN8 A;  1T1T A;  1JXC A;  1ZYV A;  4IO8 A;  1ATR A;  1T7A A;  4V1D C;  4H5T A;  1OMY A;  1I2U A;  3JXU A;  1I6F A;  1NPI A;  3QFP A;  1ATS A;  1BA1 A;  5AQM A;  2MN5 A;  5AQQ A;  1CN2 A;  3CQX A;  2BRZ A;  1ZFU A;  2QWO A;  5FPN A;  3FZH A;  1SN1 A;  4CQK A;  5FPD A;  2GL1 A;  2I61 A;  5AQN A;  1N4N A;  1QQO A;  1UGL A;  1ZU3 A;  1WT7 A;  2LY6 A;  2E3F A;  2YC1 C;  4GNI A;  1NRA A;  3D2F B;  3LDL A;  3IUC A;  2LJ7 A;  5AQG A;  1NE5 A;  2KBK A;  2E2F A;  4UAD E;  5AQZ A;  2QW9 A;  1ZUT A;  2KSK A;  2ASC A;  3CW4 A;  1KV0 A;  2SN3 A;  5AQO A;  4H5N A;  2KPY A; 
#chains in the Genus database with same CATH homology
 1LQH A;  1ZVG A;  1OZZ A;  1ZVE A;  1WMT A;  1VNB A;  1GPS A;  3E7U X;  1PX9 A;  1PE4 A;  1SEG A;  1NH5 A;  2KJA A;  1GPT A;  1BK8 A;  4HHF A;  1B7D A;  2B68 A;  1SN4 A;  2MZ0 A;  1B3C A;  1PTX A;  2LI7 A;  1JZB A;  1LQI A;  1FH3 A;  1DQ7 A;  1NRB A;  4AB0 A;  1T7B A;  2NY9 X;  2NY8 X;  2LY5 A;  1P0A A;  2N69 A;  2KBJ A;  1C55 A;  1ZYW A;  1BRZ A;  1MYN A;  2LT8 A;  1ICA A;  3E7R L;  1TI5 A;  1T0Z A;  1I2V A;  5CY0 A;  1I6G A;  1JKZ A;  1AHO A;  2YBR C;  1C56 A;  4UJ0 A;  2E0H A;  1T7E A;  2E3G A;  5KK4 A;  4KYP A;  2N66 A;  1SNB A;  2LKB A;  1AYJ A;  2N2R A;  1WWN A;  2KYQ A;  1DJT A;  1JZA A;  2A7T A;  2KGQ A;  1LQQ A;  2LJM A;  4AAZ A;  3PSM A;  2YEO A;  4HE7 A;  1BMR A;  1L4V A;  2LR3 A;  1CHZ A;  2KBH A;  2B3C A;  1P00 A;  1BCG A;  2N2Q A;  1MR4 A;  1VNA A;  2ATB A;  4AEI A;  2M8B B;  1T1T A;  1JXC A;  1ZYV A;  1T7A A;  4V1D C;  1OMY A;  1I2U A;  1I6F A;  1NPI A;  1CN2 A;  2BRZ A;  1ZFU A;  1SN1 A;  4CQK A;  2GL1 A;  2I61 A;  1N4N A;  1ZU3 A;  1WT7 A;  2LY6 A;  2E3F A;  2YC1 C;  1NRA A;  2LJ7 A;  1NE5 A;  2KBK A;  1ZUT A;  2KSK A;  2ASC A;  1KV0 A;  2SN3 A;  2KPY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...