1I6GA

Nmr solution structure of the insect-specific neurotoxin variant 5 (cse-v5) from the scorpion centruroides sculpturatus ewing
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
60
structure length
60
Chain Sequence
KDGYPVDSKGCKLSCVANNYCDNQCKMKKASGGHCYAMSCYCEGLPENAKVSDSATNICG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords NEUROTOXIN V-5
publication title Solution structure of an insect-specific neurotoxin from the New World scorpion Centruroides sculpturatus Ewing.
pubmed doi rcsb
total genus 10
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00537 Toxin_3 Scorpion toxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.10 Alpha Beta 2-Layer Sandwich Defensin A-like Knottin, scorpion toxin-like 1i6gA00
1ICAA 2LY5A 4CQKA 1MYNA 5KK4A 1NRAA 1NPIA 1NRBA 2KJAA 1CHZA 1ZYVA 1MR4A 1SEGA 1ZUTA 1JXCA 1CN2A 1I6FA 2KBHA 2LJ7A 2LT8A 2N69A 2N2QA 2BRZA 1OZZA 1LQHA 2KPYA 1JZBA 2KGQA 1TI5A 2E3GA 2LJMA 1NE5A 1JZAA 2I61A 1T7EA 1NH5A 1T7BA 1LQIA 1DJTA 2E0HA 4HHFA 5CY0A 1B7DA 4AB0A 1FH3A 1SNBA 1P00A 1DQ7A 1BRZA 1T1TA 4AEIA 1GPSA 2YBRC 2KSKA 1OMYA 1N4NA 3E7UX 1PE4A 1B3CA 1WT7A 3PSMA 1T7AA 4V1DC 1VNAA 1WWNA 1ZVEA 2N2RA 4AAZA 1KV0A 1C56A 3E7RL 2E3FA 1BK8A 2KYQA 2NY9X 1AHOA 2ASCA 2YEOA 2LY6A 1C55A 1L4VA 1LQQA 2MZ0A 4KYPA 1BMRA 1SN1A 2A7TA 1ZU3A 1ZYWA 2GL1A 2LKBA 2LR3A 2YC1C 1P0AA 1T0ZA 2NY8X 1I2VA 2B3CA 2N66A 1AYJA 1SN4A 1I6GA 4UJ0A 1PX9A 1ZVGA 2KBKA 1I2UA 2LI7A 1BCGA 2SN3A 2B68A 2M8BB 1JKZA 1ZFUA 4HE7A 1PTXA 1VNBA 2ATBA 1GPTA 1WMTA 2KBJA
chains in the Genus database with same CATH superfamily
3BK3C 1KAXA 2BUPA 3QMLA 1NGIA 1ICAA 2LY5A 4CQKA 1MYNA 4KBOA 5AR0A 5KK4A 5AQVA 1NRAA 1NPIA 5AQUA 3IUCA 1NGBA 1NRBA 3KC6A 2KJAA 1CHZA 3GKUA 1ZYVA 1MR4A 3QI7A 1SEGA 4H5WA 1QQOA 1ZUTA 3KOZA 5AQQA 3SF4D 3FZFA 1JXCA 3I33A 3LDNA 4H5NA 1CN2A 1HX1A 1I6FA 2KBHA 2LJ7A 2LT8A 3C7NB 5AQPA 2N69A 4UADE 2N2QA 2BRZA 3KOWA 1DKGD 1OZZA 3ATUA 3LDQA 1LQHA 5BPNA 2QWLA 2KPYA 5AQMA 5BN8A 1ATRA 1KAZA 4FSVA 1JZBA 2KHOA 5AQWA 2KGQA 1TI5A 2GMOA 2E3GA 2LJMA 1NE5A 5AQTA 5FPNA 1JZAA 3HSCA 3LDOA 5F1XA 2I61A 1NGAA 1T7EA 3C7NA 1NH5A 1T7BA 2VY6A 3L4IA 3ATVA 5AQIA 1LQIA 1DJTA 2E0HA 4HHFA 3LDLA 5AQZA 5CY0A 1B7DA 1BUPA 1KAYA 1QQNA 4AB0A 4IO8A 4UAFE 1FH3A 1SNBA 1P00A 5EX5A 2MBKA 3KVGA 2LN8A 3L56A 1HPMA 1DQ7A 2E8AA 2YIPA 1UGLA 4FL9A 1NGEA 1BRZA 2JDQD 2V7ZA 1T1TA 4AEIA 1GPSA 3JXUA 2YBRC 2KSKA 1OMYA 1N4NA 3E7UX 2QWPA 1PE4A 3M3ZA 3L6QA 1B3CA 1WT7A 1BA1A 5BPMA 3PSMA 5AQOA 3CW4A 5AQYA 3FZHA 1NGDA 1NGFA 3KP0A 4UAEF 5AQJA 1T7AA 1YUWA 4V1DC 1VNAA 1NGJA 5AQHA 5AQLA 3A8YA 1WWNA 1NGCA 1ZVEA 2N2RA 4AAZA 1KV0A 1C56A 3E7RL 5F2RA 2E3FA 5FPDA 2KYQA 2NY9X 2QWRA 1BK8A 5AQFA 1AHOA 3D2FB 3FE1A 2ASCA 2YEOA 1K8BA 2LY6A 1C55A 5AQGA 1LQQA 2MZ0A 4KYPA 1BMRA 1L4VA 1SN1A 3R2VA 2A7TA 1ZU3A 5FPMA 1ZYWA 5EXWA 1XRSB 5BN9A 2GL1A 2LKBA 3KP1A 1BA0A 2LR3A 2QWQA 2YC1C 4H5VA 2G2KA 1P0AA 4H5RA 5AQNA 2QW9A 1T0ZA 1HJOA 5FPEA 2NY8X 1I2VA 5EY4A 5AQRA 2B3CA 2N66A 3D2FA 3KHWA 2E2FA 3LDPA 1AYJA 2QWNA 3GDQA 3FZKA 3KOYA 1SN4A 1QQMA 3D2EB 4UJ0A 1I6GA 2YIOA 1S3XA 1PX9A 3QFPA 5AQSA 5BPLA 4GNIA 2MN5A 1ZVGA 4H5TA 3KOXA 5AQXA 3CQXA 5AQKA 2KBKA 1I2UA 2LI7A 3AY9A 1BCGA 2SN3A 1ATSA 3FZMA 2D56A 2B68A 2M8BB 3FZLA 5F0XA 4HWIA 3QFUA 1JKZA 1ZFUA 1POIA 3GL1A 1NGHA 4HE7A 2QXLA 2QWMA 1PTXA 1VNBA 3D2EA 2ATBA 1NGGA 2E88A 1GPTA 2YILA 5EVZA 1WMTA 2K35A 2QWOA 2KBJA
chains in the Genus database with same CATH topology
1ICAA 2LY5A 4CQKA 1MYNA 5KK4A 1NRAA 1NPIA 1NRBA 2KJAA 1CHZA 1ZYVA 1MR4A 1SEGA 1ZUTA 1JXCA 1CN2A 1I6FA 2KBHA 2LJ7A 2LT8A 2N69A 2N2QA 2BRZA 1OZZA 1LQHA 2KPYA 1JZBA 2KGQA 1TI5A 2E3GA 2LJMA 1NE5A 1JZAA 2I61A 1T7EA 1NH5A 1T7BA 1LQIA 1DJTA 2E0HA 4HHFA 5CY0A 1B7DA 4AB0A 1FH3A 1SNBA 1P00A 1DQ7A 1BRZA 1T1TA 4AEIA 1GPSA 2YBRC 2KSKA 1OMYA 1N4NA 3E7UX 1PE4A 1B3CA 1WT7A 3PSMA 1T7AA 4V1DC 1VNAA 1WWNA 1ZVEA 2N2RA 4AAZA 1KV0A 1C56A 3E7RL 2E3FA 1BK8A 2KYQA 2NY9X 1AHOA 2ASCA 2YEOA 2LY6A 1C55A 1L4VA 1LQQA 2MZ0A 4KYPA 1BMRA 1SN1A 2A7TA 1ZU3A 1ZYWA 2GL1A 2LKBA 2LR3A 2YC1C 1P0AA 1T0ZA 2NY8X 1I2VA 2B3CA 2N66A 1AYJA 1SN4A 1I6GA 4UJ0A 1PX9A 1ZVGA 2KBKA 1I2UA 2LI7A 1BCGA 2SN3A 2B68A 2M8BB 1JKZA 1ZFUA 4HE7A 1PTXA 1VNBA 2ATBA 1GPTA 1WMTA 2KBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ICA A;  2LY5 A;  4CQK A;  1MYN A;  5KK4 A;  1NRA A;  1NPI A;  1NRB A;  2KJA A;  1CHZ A;  1ZYV A;  1MR4 A;  1SEG A;  1ZUT A;  1JXC A;  1CN2 A;  1I6F A;  2KBH A;  2LJ7 A;  2LT8 A;  2N69 A;  2N2Q A;  2BRZ A;  1OZZ A;  1LQH A;  2KPY A;  1JZB A;  2KGQ A;  1TI5 A;  2E3G A;  2LJM A;  1NE5 A;  1JZA A;  2I61 A;  1T7E A;  1NH5 A;  1T7B A;  1LQI A;  1DJT A;  2E0H A;  4HHF A;  5CY0 A;  1B7D A;  4AB0 A;  1FH3 A;  1SNB A;  1P00 A;  1DQ7 A;  1BRZ A;  1T1T A;  4AEI A;  1GPS A;  2YBR C;  2KSK A;  1OMY A;  1N4N A;  3E7U X;  1PE4 A;  1B3C A;  1WT7 A;  3PSM A;  1T7A A;  4V1D C;  1VNA A;  1WWN A;  1ZVE A;  2N2R A;  4AAZ A;  1KV0 A;  1C56 A;  3E7R L;  2E3F A;  1BK8 A;  2KYQ A;  2NY9 X;  1AHO A;  2ASC A;  2YEO A;  2LY6 A;  1C55 A;  1L4V A;  1LQQ A;  2MZ0 A;  4KYP A;  1BMR A;  1SN1 A;  2A7T A;  1ZU3 A;  1ZYW A;  2GL1 A;  2LKB A;  2LR3 A;  2YC1 C;  1P0A A;  1T0Z A;  2NY8 X;  1I2V A;  2B3C A;  2N66 A;  1AYJ A;  1SN4 A;  1I6G A;  4UJ0 A;  1PX9 A;  1ZVG A;  2KBK A;  1I2U A;  2LI7 A;  1BCG A;  2SN3 A;  2B68 A;  2M8B B;  1JKZ A;  1ZFU A;  4HE7 A;  1PTX A;  1VNB A;  2ATB A;  1GPT A;  1WMT A;  2KBJ A; 
#chains in the Genus database with same CATH topology
 3BK3 C;  1KAX A;  2BUP A;  3QML A;  1NGI A;  1ICA A;  2LY5 A;  4CQK A;  1MYN A;  4KBO A;  5AR0 A;  5KK4 A;  5AQV A;  1NRA A;  1NPI A;  5AQU A;  3IUC A;  1NGB A;  1NRB A;  3KC6 A;  2KJA A;  1CHZ A;  3GKU A;  1ZYV A;  1MR4 A;  3QI7 A;  1SEG A;  4H5W A;  1QQO A;  1ZUT A;  3KOZ A;  5AQQ A;  3SF4 D;  3FZF A;  1JXC A;  3I33 A;  3LDN A;  4H5N A;  1CN2 A;  1HX1 A;  1I6F A;  2KBH A;  2LJ7 A;  2LT8 A;  3C7N B;  5AQP A;  2N69 A;  4UAD E;  2N2Q A;  2BRZ A;  3KOW A;  1DKG D;  1OZZ A;  3ATU A;  3LDQ A;  1LQH A;  5BPN A;  2QWL A;  2KPY A;  5AQM A;  5BN8 A;  1ATR A;  1KAZ A;  4FSV A;  1JZB A;  2KHO A;  5AQW A;  2KGQ A;  1TI5 A;  2GMO A;  2E3G A;  2LJM A;  1NE5 A;  5AQT A;  5FPN A;  1JZA A;  3HSC A;  3LDO A;  5F1X A;  2I61 A;  1NGA A;  1T7E A;  3C7N A;  1NH5 A;  1T7B A;  2VY6 A;  3L4I A;  3ATV A;  5AQI A;  1LQI A;  1DJT A;  2E0H A;  4HHF A;  3LDL A;  5AQZ A;  5CY0 A;  1B7D A;  1BUP A;  1KAY A;  1QQN A;  4AB0 A;  4IO8 A;  4UAF E;  1FH3 A;  1SNB A;  1P00 A;  5EX5 A;  2MBK A;  3KVG A;  2LN8 A;  3L56 A;  1HPM A;  1DQ7 A;  2E8A A;  2YIP A;  1UGL A;  4FL9 A;  1NGE A;  1BRZ A;  2JDQ D;  2V7Z A;  1T1T A;  4AEI A;  1GPS A;  3JXU A;  2YBR C;  2KSK A;  1OMY A;  1N4N A;  3E7U X;  2QWP A;  1PE4 A;  3M3Z A;  3L6Q A;  1B3C A;  1WT7 A;  1BA1 A;  5BPM A;  3PSM A;  5AQO A;  3CW4 A;  5AQY A;  3FZH A;  1NGD A;  1NGF A;  3KP0 A;  4UAE F;  5AQJ A;  1T7A A;  1YUW A;  4V1D C;  1VNA A;  1NGJ A;  5AQH A;  5AQL A;  3A8Y A;  1WWN A;  1NGC A;  1ZVE A;  2N2R A;  4AAZ A;  1KV0 A;  1C56 A;  3E7R L;  5F2R A;  2E3F A;  5FPD A;  2KYQ A;  2NY9 X;  2QWR A;  1BK8 A;  5AQF A;  1AHO A;  3D2F B;  3FE1 A;  2ASC A;  2YEO A;  1K8B A;  2LY6 A;  1C55 A;  5AQG A;  1LQQ A;  2MZ0 A;  4KYP A;  1BMR A;  1L4V A;  1SN1 A;  3R2V A;  2A7T A;  1ZU3 A;  5FPM A;  1ZYW A;  5EXW A;  1XRS B;  5BN9 A;  2GL1 A;  2LKB A;  3KP1 A;  1BA0 A;  2LR3 A;  2QWQ A;  2YC1 C;  4H5V A;  2G2K A;  1P0A A;  4H5R A;  5AQN A;  2QW9 A;  1T0Z A;  1HJO A;  5FPE A;  2NY8 X;  1I2V A;  5EY4 A;  5AQR A;  2B3C A;  2N66 A;  3D2F A;  3KHW A;  2E2F A;  3LDP A;  1AYJ A;  2QWN A;  3GDQ A;  3FZK A;  3KOY A;  1SN4 A;  1QQM A;  3D2E B;  4UJ0 A;  1I6G A;  2YIO A;  1S3X A;  1PX9 A;  3QFP A;  5AQS A;  5BPL A;  4GNI A;  2MN5 A;  1ZVG A;  4H5T A;  3KOX A;  5AQX A;  3CQX A;  5AQK A;  2KBK A;  1I2U A;  2LI7 A;  3AY9 A;  1BCG A;  2SN3 A;  1ATS A;  3FZM A;  2D56 A;  2B68 A;  2M8B B;  3FZL A;  5F0X A;  4HWI A;  3QFU A;  1JKZ A;  1ZFU A;  1POI A;  3GL1 A;  1NGH A;  4HE7 A;  2QXL A;  2QWM A;  1PTX A;  1VNB A;  3D2E A;  2ATB A;  1NGG A;  2E88 A;  1GPT A;  2YIL A;  5EVZ A;  1WMT A;  2K35 A;  2QWO A;  2KBJ A; 
#chains in the Genus database with same CATH homology
 1ICA A;  2LY5 A;  4CQK A;  1MYN A;  5KK4 A;  1NRA A;  1NPI A;  1NRB A;  2KJA A;  1CHZ A;  1ZYV A;  1MR4 A;  1SEG A;  1ZUT A;  1JXC A;  1CN2 A;  1I6F A;  2KBH A;  2LJ7 A;  2LT8 A;  2N69 A;  2N2Q A;  2BRZ A;  1OZZ A;  1LQH A;  2KPY A;  1JZB A;  2KGQ A;  1TI5 A;  2E3G A;  2LJM A;  1NE5 A;  1JZA A;  2I61 A;  1T7E A;  1NH5 A;  1T7B A;  1LQI A;  1DJT A;  2E0H A;  4HHF A;  5CY0 A;  1B7D A;  4AB0 A;  1FH3 A;  1SNB A;  1P00 A;  1DQ7 A;  1BRZ A;  1T1T A;  4AEI A;  1GPS A;  2YBR C;  2KSK A;  1OMY A;  1N4N A;  3E7U X;  1PE4 A;  1B3C A;  1WT7 A;  3PSM A;  1T7A A;  4V1D C;  1VNA A;  1WWN A;  1ZVE A;  2N2R A;  4AAZ A;  1KV0 A;  1C56 A;  3E7R L;  2E3F A;  1BK8 A;  2KYQ A;  2NY9 X;  1AHO A;  2ASC A;  2YEO A;  2LY6 A;  1C55 A;  1L4V A;  1LQQ A;  2MZ0 A;  4KYP A;  1BMR A;  1SN1 A;  2A7T A;  1ZU3 A;  1ZYW A;  2GL1 A;  2LKB A;  2LR3 A;  2YC1 C;  1P0A A;  1T0Z A;  2NY8 X;  1I2V A;  2B3C A;  2N66 A;  1AYJ A;  1SN4 A;  1I6G A;  4UJ0 A;  1PX9 A;  1ZVG A;  2KBK A;  1I2U A;  2LI7 A;  1BCG A;  2SN3 A;  2B68 A;  2M8B B;  1JKZ A;  1ZFU A;  4HE7 A;  1PTX A;  1VNB A;  2ATB A;  1GPT A;  1WMT A;  2KBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...